DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a2 and CYP72A13

DIOPT Version :9

Sequence 1:NP_523628.1 Gene:Cyp6a2 / 35587 FlyBaseID:FBgn0000473 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_188084.1 Gene:CYP72A13 / 820694 AraportID:AT3G14660 Length:512 Species:Arabidopsis thaliana


Alignment Length:418 Identity:114/418 - (27%)
Similarity:184/418 - (44%) Gaps:64/418 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PAAFIVDTQLAKNILIKDFSNFADRGQFHNGRDDPLTQHLFNLDGKKWKDMRQRLTPTFTSGKMK 143
            |...|:|.:..|.:..|.: :|.....|..||  .:...|.:.||.||...|:.:.|.|...|:|
plant   104 PTITIMDPEQIKEVFNKVY-DFQKAHTFPLGR--LIAAGLVSYDGDKWTKHRRIINPAFHLEKIK 165

  Fly   144 FMFPTVIKVSEEFV----KVITEQVPAAQNGAVLEIKELMARFTTDVIGTCAFGIECNTLRTPVS 204
            .|.|...:...|.|    |::|::    |:...::|...:...|.|||...|||          |
plant   166 NMVPAFHQSCSEIVGEWDKLVTDK----QSSCEVDIWPWLVSMTADVISRTAFG----------S 216

  Fly   205 DFRTMGQKVFTDMRHGKLLTMFVFS---------FPKLASRLRMRMMPEDVHQFFMR-LVNDTIA 259
            .::. ||::|........|.:..|.         ||...:| ||:....:: :|.:| :||..:.
plant   217 SYKE-GQRIFELQAELAQLIIQAFRKAIIPGYRYFPTKGNR-RMKAAAREI-KFILRGIVNKRLR 278

  Fly   260 LRERENFKRNDFMNLLIEL---KQKGRVTLDNGEVIEGMDIGELAAQVFVFYVAGFETSSSTMSY 321
            .||......:|.:.:|:|.   :.||          .||...||..:..:||.||.||::..:.:
plant   279 AREAGEAPSDDLLGILLESNLGQTKG----------NGMSTEELMEECKLFYFAGQETTTVLLVW 333

  Fly   322 CLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYESIKAMTYLNQVISETLRLYTLVPHLER----- 381
            .:..|:|:||.|.|.|.|::.|..::|...  |.:..:..:..::.|.||||..|..|.|     
plant   334 TMVLLSQHQDWQARAREEVKQVFGDKEPDA--EGLNQLKVMTMILYEVLRLYPPVVQLTRAIHKE 396

  Fly   382 KALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYPNPE-TFDPERFSPE-KVAARESVEWLPF 444
            ..|.|..:||        |.|:.:|.....||.:|:.|.. .|.|:||... ..|.:..|.:.||
plant   397 MQLGDLTLPG--------GVQISLPILLIQRDRELWGNDAGEFKPDRFKDGLSKATKNQVSFFPF 453

  Fly   445 GDGPRNCIGMRFGQMQARIGLAQIISRF 472
            ..|||.|||..|..::|::.:..|:.:|
plant   454 AWGPRICIGQNFALLEAKMAMTLILRKF 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a2NP_523628.1 p450 36..502 CDD:278495 114/418 (27%)
CYP72A13NP_188084.1 p450 24..512 CDD:299894 114/418 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.