DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a2 and CYP72A8

DIOPT Version :9

Sequence 1:NP_523628.1 Gene:Cyp6a2 / 35587 FlyBaseID:FBgn0000473 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_188080.1 Gene:CYP72A8 / 820690 AraportID:AT3G14620 Length:515 Species:Arabidopsis thaliana


Alignment Length:507 Identity:125/507 - (24%)
Similarity:219/507 - (43%) Gaps:115/507 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RNFNYWNRRG-------------------VPHDAPHPLYGNMVGFRKNRVMHDFFYDYYNKYRKS 66
            :|..|..|:|                   |..:...|:  |:.....:||| .........:.|:
plant    38 KNEAYLKRQGLSGTPFTFLVGDIKREASMVEQEKSRPI--NLTDDYTHRVM-PLIQQTVKDHGKT 99

  Fly    67 GFPFVGFYFLHKPAAFIVDT--QLAKNIL--IKDFSNFADRGQFHNGRDDPLTQHLFN-----LD 122
            .:.::|      |.|.::.|  :..|::|  :.||    .:...|     |:.: ||.     .:
plant   100 SYMWMG------PIASVIVTKPEHIKDVLNRVYDF----PKPPVH-----PIVE-LFATGVALYE 148

  Fly   123 GKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFV----KVITEQVPAAQNGAVLEIKELMARFT 183
            |:||...|:.:.|:|...|:|.|.|...:...|.:    |::|||..:.:    :::...:...|
plant   149 GEKWSKHRKIINPSFHLEKLKIMIPAFYESCSEMISKWEKLVTEQGSSNE----IDVWPYLGDLT 209

  Fly   184 TDVIGTCAFGIECNTLRTPVSDFRTMGQKVF-TDMRHGKLLTMFVFSFPKLASRLRMRMMPEDVH 247
            :|||...|||          |.:.. |:::| .....|:.    |....:||....||.:|.. :
plant   210 SDVISRTAFG----------SSYEE-GKRIFELQEEQGRR----VLKALELAFIPGMRFLPTK-N 258

  Fly   248 QFFMRLVNDTIALRERE------------NFKRNDFMNLLIELKQKGRVTLDNGEVIEGMDIGEL 300
            ...||.:|..:..|.||            ...:||.:.:|:|        .::|:  .||.|.::
plant   259 NLRMRQINKEVKSRLREIIMKRQRGMDTGEAPKNDLLGILLE--------SNSGD--HGMSIEDV 313

  Fly   301 AAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYESIKAMTYLNQV 365
            ..:..:|:.||.||::..:.:.:..|:.:|..||:.|.||..|: .:..:..::::..:..::.:
plant   314 VEECRLFHFAGQETTAVLLVWTMIMLSHHQKWQDQAREEILKVI-GKNNKPNFDALSRLKTMSMI 377

  Fly   366 ISETLRLYTLVPHL--------ERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLY-PNPE 421
            ::|.||||.  |.:        |.|...|..:||        |.||:||....|||.:|: .:..
plant   378 LNEVLRLYP--PGILLGRTVEKETKLGEDMTLPG--------GAQVVIPVLMVHRDPELWGEDVH 432

  Fly   422 TFDPERFSPE-KVAARESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRF 472
            .|:||||:.. ..|.:..|.:||||.|||.|.|..|..|:|::.|..|:.||
plant   433 EFNPERFADGISKATKNQVSFLPFGWGPRFCPGQNFALMEAKMALVLILQRF 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a2NP_523628.1 p450 36..502 CDD:278495 120/473 (25%)
CYP72A8NP_188080.1 p450 26..515 CDD:299894 125/507 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.