DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a2 and CYP72A7

DIOPT Version :9

Sequence 1:NP_523628.1 Gene:Cyp6a2 / 35587 FlyBaseID:FBgn0000473 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_188079.1 Gene:CYP72A7 / 820689 AraportID:AT3G14610 Length:512 Species:Arabidopsis thaliana


Alignment Length:434 Identity:115/434 - (26%)
Similarity:190/434 - (43%) Gaps:63/434 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNILIKDFSNFADRGQFHNGRDDPLTQ----HLFNL 121
            |.:.|:.|.::|      |...||.|...:   ||:..|..:  .|......||.:    .|.:.
plant    89 NSHGKTFFIWIG------PLPTIVITNPEQ---IKEVFNKVN--DFEKASTFPLIRLLAGGLASY 142

  Fly   122 DGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFV----KVITEQVPAAQNGAVLEIKELMARF 182
            .|.||...|:.:.|.|...|:|.|.|.......|.|    |:.|::    ::...:::...:...
plant   143 KGDKWASHRRIINPAFHLEKIKNMIPAFYHCCSEVVCQWEKLFTDK----ESPLEVDVWPWLVNM 203

  Fly   183 TTDVIGTCAFGIECNTLRTPVSDFRTMGQKVFTDMRHGKLLTMFVFSFPK----------LASRL 237
            |.|||...|||          |.::. ||::|  ...|:|..:...:|.|          ..|..
plant   204 TADVISHTAFG----------SSYKE-GQRIF--QLQGELAELIAQAFKKSYIPGSRFYPTKSNR 255

  Fly   238 RMRMMPEDVHQFFMRLVNDTIALRERENFKRNDFMNLLIELKQKGRVTLDNGEVIE--GMDIGEL 300
            ||:.:..:|......:|:.....||......:|.:.:|:|         .|.|..:  ||.:.::
plant   256 RMKAIDREVDVILRGIVSKREKAREAGEPANDDLLGILLE---------SNSEESQGNGMSVEDV 311

  Fly   301 AAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYESIKAMTYLNQV 365
            ..:..:||.||.||:|..:.:.:..|:.:||.|.|.|.|:..||.| ..:...||:..:..:..:
plant   312 MKECKLFYFAGQETTSVLLVWTMVLLSHHQDWQARAREEVMQVLGE-NNKPDMESLNNLKVMTMI 375

  Fly   366 ISETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLY-PNPETFDPERFS 429
            .:|.||||..|..|:| .:|..:..|  :|.:..|.|:.:|.....||.:|: .:...|.||||.
plant   376 FNEVLRLYPPVAQLKR-VVNKEMKLG--ELTLPAGIQIYLPTILVQRDTELWGDDAADFKPERFR 437

  Fly   430 PE-KVAARESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRF 472
            .. ..|.:..|.:.|||.|||.|||..|..::|::.:|.|:.:|
plant   438 DGLSKATKNQVSFFPFGWGPRICIGQNFAMLEAKMAMALILQKF 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a2NP_523628.1 p450 36..502 CDD:278495 115/434 (26%)
CYP72A7NP_188079.1 p450 21..512 CDD:299894 115/434 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.