DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a2 and CYP90D1

DIOPT Version :10

Sequence 1:NP_523628.1 Gene:Cyp6a2 / 35587 FlyBaseID:FBgn0000473 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_566462.1 Gene:CYP90D1 / 820582 AraportID:AT3G13730 Length:491 Species:Arabidopsis thaliana


Alignment Length:59 Identity:13/59 - (22%)
Similarity:22/59 - (37%) Gaps:18/59 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VLSEDGSVHASGGELENDERSANIISNLLTLTESVDPAVFSARSCRKVSIVFADHSYTI 75
            :|:|:.|:|...|........:....|||.|:::                  |..|||:
plant   472 ILAEERSMHYGSGSSGFRLPQSMSTGNLLALSQA------------------ASSSYTL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a2NP_523628.1 CYP6-like 69..500 CDD:410679 4/7 (57%)
CYP90D1NP_566462.1 PLN03141 44..491 CDD:215600 5/18 (28%)

Return to query results.
Submit another query.