DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a2 and CYP4F11

DIOPT Version :9

Sequence 1:NP_523628.1 Gene:Cyp6a2 / 35587 FlyBaseID:FBgn0000473 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001122404.1 Gene:CYP4F11 / 57834 HGNCID:13265 Length:524 Species:Homo sapiens


Alignment Length:400 Identity:109/400 - (27%)
Similarity:197/400 - (49%) Gaps:41/400 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 GKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVITE--QVPAAQNGAVLEIKELMARFTTD 185
            |.||...|:.|||.|....:|    ..:|:..:.|.::.:  |..|::..|.|::.|.::..|.|
Human   141 GDKWSRHRRMLTPAFHFNILK----PYMKIFNKSVNIMHDKWQRLASEGSARLDMFEHISLMTLD 201

  Fly   186 VIGTCAFGIECNTLRTPVSDF--RTMGQKVFTDMRHGKLLTMFVFSFPKLASRLRMRMMPEDVHQ 248
            .:..|.|..|.|....| |::  ..:....|.:.|:.::|....|.:.......|.|.....||.
Human   202 SLQKCVFSFESNCQEKP-SEYIAAILELSAFVEKRNQQILLHTDFLYYLTPDGQRFRRACHLVHD 265

  Fly   249 FFMRLVND---TIALRERENFKRN-------DFMNLLIELKQKGRVTLDNGEVIEGMDIGELAAQ 303
            |...::.:   |:..:..::|.:|       ||:::|:..|.      ::|:.:...||   .|:
Human   266 FTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFIDVLLLSKD------EDGKELSDEDI---RAE 321

  Fly   304 VFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEG-QLTYESIKAMTYLNQVIS 367
            ...|...|.:|::|.:|:.||.||::.:.|::.|.|:|.:|:::|. ::.::.:..:.:|...|.
Human   322 ADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQELLKDREPIEIEWDDLAQLPFLTMCIK 386

  Fly   368 ETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYPNPETFDPERFSPEK 432
            |:|||:..||.:.|....|:|:|  :..||.||...:|.....|.:..::|:||.:||.||..|.
Human   387 ESLRLHPPVPVISRCCTQDFVLP--DGRVIPKGIVCLINIIGIHYNPTVWPDPEVYDPFRFDQEN 449

  Fly   433 VAARESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVCDTTEIPLKYSPM---SIVLG 494
            :..|..:.::||..|||||||..|...:.::.||..:..||:       :|....|.   .::|.
Human   450 IKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFRI-------LPTHTEPRRKPELILR 507

  Fly   495 TVGGIYLRVE 504
            ..||::||||
Human   508 AEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a2NP_523628.1 p450 36..502 CDD:278495 105/396 (27%)
CYP4F11NP_001122404.1 p450 52..506 CDD:365848 102/387 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.