DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a2 and Cyp4c3

DIOPT Version :9

Sequence 1:NP_523628.1 Gene:Cyp6a2 / 35587 FlyBaseID:FBgn0000473 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster


Alignment Length:535 Identity:122/535 - (22%)
Similarity:225/535 - (42%) Gaps:116/535 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLIYLLI---AISSLLAYLYHRNFNYWNRRGVPHDAPHPLYGNMVGFRKNRVMHDFFYDYYNKYR 64
            :||:|::   ..|.|:.|:          ..:|..|..|..||.:   :..|.||..::.....:
  Fly    37 ILIFLVVYNKRRSRLVKYI----------EKIPGPAAMPFLGNAI---EMNVDHDELFNRVIGMQ 88

  Fly    65 KSGFPFVGFYFLHK---PAAFIVDTQLAKNILIKDFSNFADRGQFHNGRDDPLTQHLFNLDGKKW 126
            |.....:|...:.:   |...:.:.:..:.||  :...|.::...::.....|.:.|.....:||
  Fly    89 KLWGTRIGINRVWQGTAPRVLLFEPETVEPIL--NSQKFVNKSHDYDYLHPWLGEGLLTSTDRKW 151

  Fly   127 KDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVITEQVPAAQNGAVLEI-KELMARFTTDVIGTC 190
            ...|:.|||.|.           .|:.::|:.|..||.........:|: .|....|  ..:..|
  Fly   152 HSRRKILTPAFH-----------FKILDDFIDVFNEQSAVLARKLAVEVGSEAFNLF--PYVTLC 203

  Fly   191 AFGIECNTLRTPVSDFRTMGQKVF-------------------TDMRHGK--LLTMFVFSFPKLA 234
            ...|.|.|         .||::::                   ...|..|  |.:.|:||   |.
  Fly   204 TLDIVCET---------AMGRRIYAQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIFS---LT 256

  Fly   235 SRLRMRMMPEDVHQFFMRLVN--DTIALRER--------ENFKRND-----------------FM 272
            :..::       ||.::..::  ..:.:|||        ||...|:                 |:
  Fly   257 AEYKL-------HQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFL 314

  Fly   273 NLLIELKQKGRVTLDNGEVIEGMDIGELAAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLR 337
            :|||:..::|.| |.|.::.|.:|         .|...|.:|:|:.:|:.|:.|..:.:.|:|:.
  Fly   315 DLLIDASKEGTV-LSNEDIREEVD---------TFMFEGHDTTSAAISWTLFLLGCHPEYQERVV 369

  Fly   338 NEIQTVL-EEQEGQLTYESIKAMTYLNQVISETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGT 401
            .|:.::. :::|...|.:::..|.||...|.::|||:..||.:.|....|..:.|.   ::..||
  Fly   370 EELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGK---IVPAGT 431

  Fly   402 QVIIPACAYHRDEDLYPNPETFDPERFSPEKVAARESVEWLPFGDGPRNCIGMRFGQMQARIGLA 466
            |.||...|.||:..::|.||.|:|:.|.||..|.|....::||..|||||||.:|..::.:..::
  Fly   432 QAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVIS 496

  Fly   467 QIISRFRVSVCDTTE 481
            .::.::::...|..|
  Fly   497 TVLRKYKIEAVDRRE 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a2NP_523628.1 p450 36..502 CDD:278495 114/499 (23%)
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 116/503 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.