DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a2 and Cyp12a4

DIOPT Version :9

Sequence 1:NP_523628.1 Gene:Cyp6a2 / 35587 FlyBaseID:FBgn0000473 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_650783.2 Gene:Cyp12a4 / 42294 FlyBaseID:FBgn0038681 Length:536 Species:Drosophila melanogaster


Alignment Length:427 Identity:116/427 - (27%)
Similarity:183/427 - (42%) Gaps:76/427 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RGQFHNGRDDPLTQHLFNLDGKKWKDMRQRLTPTFTSGK-MKFMFPTVIKVSEEFVKVITEQVPA 166
            |..|:.|     ...:....||.|.|.|..:.|.....| ::..:..:.:|::|||:.|.|....
  Fly   136 RKDFYQG-----VMGVIPTQGKPWGDFRTVVNPVLMQPKNVRLYYKKMSQVNQEFVQRILELRDP 195

  Fly   167 AQNGAVLEIKELMARFTTDVIGTCAFGIECNTLRTPVSDFRTMGQKVFTDMRHGKLLTMFVFSF- 230
            ....|..:..:.:.|:|.:.:...|...:...|:.  |:..:...|:|    | .|...|:.|. 
  Fly   196 DTLEAPDDFIDTINRWTLESVSVVALDKQLGLLKN--SNKESEALKLF----H-YLDEFFIVSID 253

  Fly   231 -------------PKLASRLRMRMMPEDVHQFFMRLVNDTIALRERENFKRNDFMNLLIELKQKG 282
                         ||| .|| ||.: :.:.:..:..|::.|...::|              .::|
  Fly   254 LEMKPSPWRYIKTPKL-KRL-MRAL-DGIQEVTLAYVDEAIERLDKE--------------AKEG 301

  Fly   283 RVTLDNGE-VIEG-MDIGELAAQVFV--FYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTV 343
            .|..:|.: |:|. :.:....|.|..  ..:||.:|:|||.:..|..||:|.:.|.|||.|:..|
  Fly   302 VVRPENEQSVLEKLLKVDRKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKV 366

  Fly   344 LEEQEGQLTYESIKAMTYLNQVISETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQV-IIPA 407
            |..:..:.|..|:|.:.||...|.|:.||:.|:....|....|.|:.|:.   :..||.| |:|.
  Fly   367 LPNKNSEFTEASMKNVPYLRACIKESQRLHPLIVGNARVLARDAVLSGYR---VPAGTYVNIVPL 428

  Fly   408 CAYHRDEDLYPNPETFDPERF------SPEKVAARE-----SVEWLPFGDGPRNCIGMRFGQMQA 461
            .|..||| .:|....|.|||:      |..|..|.|     ...:||||.|||.|:|.|..:|:.
  Fly   429 NALTRDE-YFPQASEFLPERWLRSPKDSESKCPANELKSTNPFVFLPFGFGPRMCVGKRIVEMEL 492

  Fly   462 RIGLAQIISRFRVSVCDTTE------------IPLKY 486
            .:|.|::|..|.|.....||            ||||:
  Fly   493 ELGTARLIRNFNVEFNYPTENAFRSALINLPNIPLKF 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a2NP_523628.1 p450 36..502 CDD:278495 116/427 (27%)
Cyp12a4NP_650783.2 p450 72..531 CDD:299894 116/427 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.