DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a2 and Cyp12e1

DIOPT Version :9

Sequence 1:NP_523628.1 Gene:Cyp6a2 / 35587 FlyBaseID:FBgn0000473 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_650003.4 Gene:Cyp12e1 / 41272 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster


Alignment Length:503 Identity:118/503 - (23%)
Similarity:198/503 - (39%) Gaps:113/503 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DAPHPLYGNMV------GFRKNRVMHDFFYDYYNKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNI 92
            |.|.|....::      |..||..:|:.|.|...:|        |..| ..|:  :..|.|...:
  Fly    40 DIPGPSKLQLIRAFLPGGLYKNLPVHEMFLDMNRQY--------GSIF-RMPS--VAGTDLVLTM 93

  Fly    93 LIKDFS-NFADRGQFHNGRD-------------------DPLTQHLFNLDGKKWKDMRQRLTPTF 137
            ..:|:. .|.:.||:...|.                   |.||..    :|..|..||..:.|..
  Fly    94 NPQDYEVIFRNEGQYPYRRSFEVMDYFKRVHRREVFDGYDGLTSG----NGPAWGKMRTAVNPIL 154

  Fly   138 TSGK-MKFMFPTVIKVSEEFVK-------VITEQVPAAQNGAVLEIKELMARFTTDVIGTCAFGI 194
            ...: .|.....:::||:||::       .:|:::|   :...::|:.|:......|......|:
  Fly   155 LQPRNAKLYMTNLVQVSDEFLERIRIIRDPVTQEMP---DDFAVDIRHLVIESICSVALNTHLGL 216

  Fly   195 --------ECNTLRTPVSDFRTMGQKVFTDMRHGKLLTMFVFSFPKLASRLRMRMMPEDVHQFFM 251
                    :...|...:.|...:|.::.......|.|.|  .:|.||     ||.:.......:.
  Fly   217 LGEQRNNKDIQKLVLALQDVVELGFQLDIMPAFWKYLPM--PNFKKL-----MRSLDTITDFCYF 274

  Fly   252 RLVNDTIALRERENFKRNDFMN-------LLIELKQKGRVTLDNGEVIEGMDIGELAAQVFVFYV 309
            .:.|   ||:..|...:...:|       ||.:|.:..|.|    .||..||:          ..
  Fly   275 HIGN---ALKRIEEDAKAGTLNEIGLETSLLEKLARFDRQT----AVIIAMDL----------LF 322

  Fly   310 AGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYESIKAMTYLNQVISETLRLYT 374
            ||.:.:..|:...|:.|:::.|.|.||..||:.:|..::..||.|:::.:.||...|.|.:|:|.
  Fly   323 AGADPTLVTLGGILFSLSKSPDKQARLLEEIRGILPNKDSSLTIENMRNLPYLRACIKEGIRMYP 387

  Fly   375 LVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYPNPETFDPE--RFSPEKVAARE 437
            :.|...|:..:|.|:.|:.   :..||.|.| |..|.     ..|.|.|.|:  .|.||:....|
  Fly   388 IGPGTLRRMPHDVVLSGYR---VVAGTDVGI-AANYQ-----MANMEQFVPKVREFIPERWLRDE 443

  Fly   438 S-----------VEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRV 474
            |           ..:||||.|||:|.|.|...|...|.:::::..|::
  Fly   444 SNSHLVGETATPFMYLPFGFGPRSCAGKRIVDMMLEIAISRLVRNFKI 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a2NP_523628.1 p450 36..502 CDD:278495 117/501 (23%)
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 112/480 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.