DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a2 and CYP4A22

DIOPT Version :9

Sequence 1:NP_523628.1 Gene:Cyp6a2 / 35587 FlyBaseID:FBgn0000473 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:542 Identity:148/542 - (27%)
Similarity:239/542 - (44%) Gaps:94/542 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLIYLLIAISSLLAYLYHRNFNYWNRRGVPHDAPHPLYGNMVGFRKNRVMHDFFYDYYNKYRKSG 67
            :||.||:.|.:...|| ||.:.....:..|....|.|:|::..|:.::.:...      :.|...
Human    24 LLILLLLLIKAAQLYL-HRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRI------QERVKT 81

  Fly    68 FPFVGFYFL--HKPAAFIVDTQLAKNILIKDFSNFADRGQFHNGRDDP------------LTQHL 118
            ||....|::  .|....:.|....|.||               ||.||            :...|
Human    82 FPSACPYWIWGGKVRVQLYDPDYMKVIL---------------GRSDPKSHGSYKFLAPRIGYGL 131

  Fly   119 FNLDGKKWKDMRQRLTPTFTSGKMK----FMFPTVIKVSEEFVKVITEQVPAAQNGAVLEIKELM 179
            ..|:|:.|...|:.|||.|.:..:|    .|..:|..:.:::.:::.:..|       ||:.:.:
Human   132 LLLNGQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQDSP-------LEVFQHV 189

  Fly   180 ARFTTDVIGTCAFG------IECNTLR--TPVSDFRTMGQKVFTDMRHGKLLTMFVFSFPKLASR 236
            :..|.|.|...||.      ::.|:..  ..:||..::   ||..||:.......::|... |.|
Human   190 SLMTLDTIMKSAFSHQGSIQVDRNSQSYIQAISDLNSL---VFCCMRNAFHENDTIYSLTS-AGR 250

  Fly   237 LRMRMMPEDVHQFFMRLVNDTIALR--------ERENFKRN---DFMNLLIELKQKGRVTLDNGE 290
            ...|.. :..||.    .:..|.||        |.|..||.   ||:::|:..|      ::||.
Human   251 WTHRAC-QLAHQH----TDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAK------MENGS 304

  Fly   291 VIEGMDIGELAAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYES 355
            ::...|   |.|:|..|...|.:|::|.:|:.||.||.:...|:|.|.||..:|.: ...:|:..
Human   305 ILSDKD---LRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGD-GASITWNH 365

  Fly   356 IKAMTYLNQVISETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYPNP 420
            :..|.|....|.|.||||..||.:.|:.......|....|  .||..|::.....|.:..::||.
Human   366 LDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSL--PKGIMVLLSIYGLHHNPKVWPNL 428

  Fly   421 ETFDPERFSPEKVAARESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVCDTTEIPLK 485
            |.|||.||:|.  :|:.|..:|||..|.|||||.:|...|.::..|..:.||.: :.|.|.||: 
Human   429 EVFDPSRFAPG--SAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFEL-LPDPTRIPI- 489

  Fly   486 YSPMS-IVLGTVGGIYLRVERI 506
              ||: :||.:..||:||:.|:
Human   490 --PMARLVLKSKNGIHLRLRRL 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a2NP_523628.1 p450 36..502 CDD:278495 135/503 (27%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 136/507 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.