DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a2 and CYP4X1

DIOPT Version :9

Sequence 1:NP_523628.1 Gene:Cyp6a2 / 35587 FlyBaseID:FBgn0000473 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_828847.1 Gene:CYP4X1 / 260293 HGNCID:20244 Length:509 Species:Homo sapiens


Alignment Length:549 Identity:138/549 - (25%)
Similarity:240/549 - (43%) Gaps:104/549 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FVLIYLLIAISSLLAYLYHRNFNYWNRRGVPHDAPHPLYGNMVGFRKNRVMHDFFYDYYNKYRKS 66
            ||....|..:.::..|| .|.....:.|..|....|...|:....:.:.:  :...:...||.::
Human    18 FVFCLALGLLQAIKLYL-RRQRLLRDLRPFPAPPTHWFLGHQKFIQDDNM--EKLEEIIEKYPRA 79

  Fly    67 GFPF-VGFYFLHKPAAF--IVDTQLAKNILIKDFSNFADRGQFHNGRDDPLTQHL--FN------ 120
             ||| :|.:     .||  |.|...||.:|               .|.||.:|:|  |:      
Human    80 -FPFWIGPF-----QAFFCIYDPDYAKTLL---------------SRTDPKSQYLQKFSPPLLGK 123

  Fly   121 ----LDGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVIT---EQVPAAQNGAVLEIKEL 178
                |||.||...|:.|||.|....:|    ..|:|....||::.   |::.:.|:.:| |:.|.
Human   124 GLAALDGPKWFQHRRLLTPGFHFNILK----AYIEVMAHSVKMMLDKWEKICSTQDTSV-EVYEH 183

  Fly   179 MARFTTDVIGTCAFGIECNTLRTPVSD---------FRTMGQKVFTDMRHGKLLTMFVFSFPKLA 234
            :...:.|:|..|||..|.|.......|         .:.:..::::.:.|..::           
Human   184 INSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDII----------- 237

  Fly   235 SRLRMRMMPEDVH-QFFMRLVN---DTIALRERENF-------------KRNDFMNLLIELKQKG 282
                .::.|:... |...|::|   ||| ::||:..             |..||:::::..|.  
Human   238 ----FKLSPQGYRFQKLSRVLNQYTDTI-IQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKD-- 295

  Fly   283 RVTLDNGEVIEGMDIGELAAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQ 347
                ::|.....:|:   .::|..|.:||.:|.::::|:.||.||.|.:.|:|.|.|::.:|.: 
Human   296 ----ESGSSFSDIDV---HSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGD- 352

  Fly   348 EGQLTYESIKAMTYLNQVISETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHR 412
            ...:|::.:..|:|....|.||.||...||.:.|........|  :...:..|..|::.....|.
Human   353 GSSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFP--DGCTLPAGITVVLSIWGLHH 415

  Fly   413 DEDLYPNPETFDPERFSPEKVAARESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVC 477
            :..::.||:.|||.|||.|....|....:|||..|.|||||..|..::.::.:|.|:..|||:. 
Human   416 NPAVWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTP- 479

  Fly   478 DTTEIPLKYSPMSIVLGTVGGIYLRVERI 506
            |.|. ||.: |...:|....|:||.::::
Human   480 DPTR-PLTF-PNHFILKPKNGMYLHLKKL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a2NP_523628.1 p450 36..502 CDD:278495 129/509 (25%)
CYP4X1NP_828847.1 p450 47..501 CDD:306555 129/512 (25%)
heme binding region 447..460 7/12 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.