DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a2 and Cyp4a14

DIOPT Version :9

Sequence 1:NP_523628.1 Gene:Cyp6a2 / 35587 FlyBaseID:FBgn0000473 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_031848.1 Gene:Cyp4a14 / 13119 MGIID:1096550 Length:507 Species:Mus musculus


Alignment Length:440 Identity:115/440 - (26%)
Similarity:195/440 - (44%) Gaps:82/440 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GRDDPLTQHLFN------------LDGKKWKDMRQRLTPTF----TSGKMKFMFPTVIKVSEEFV 157
            ||.||....::.            |:||||...|:.|||.|    ....:|.|..:|..:.:::.
Mouse   107 GRSDPKASGIYQFFAPWIGYGLLLLNGKKWFQHRRMLTPAFHYDILKPYVKIMADSVNIMLDKWE 171

  Fly   158 KVITEQVPAAQNGAVLEIKELMARFTTDVIGTCAFGIECNTLRTPVSDFRTMGQKVFTDMRHGKL 222
            |:..:..|       |||...::..|.|.:..|||..:.:......|...|   |...|:.:   
Mouse   172 KLDGQDHP-------LEIFHCVSLMTLDTVMKCAFSYQGSVQLDENSKLYT---KAVEDLNN--- 223

  Fly   223 LTMFVFSFPKLASRLRMRMMPEDV------------H--QFFMRLVNDTIALR----------ER 263
            ||.|         |||......::            |  |......:..|.:|          ::
Mouse   224 LTFF---------RLRNAFYKYNIIYNMSSDGRLSHHACQIAHEHTDGVIKMRKSQLQNEEELQK 279

  Fly   264 ENFKRN-DFMNLLIELKQKGRVTLDNGEVIEGMDIGELAAQVFVFYVAGFETSSSTMSYCLYELA 327
            ...||: ||:::|:..:.:.|.:|.:         .:|.|:|..|...|.:|::|.:|:..|.||
Mouse   280 ARKKRHLDFLDILLFARMEDRNSLSD---------EDLRAEVDTFMFEGHDTTASGISWIFYALA 335

  Fly   328 QNQDIQDRLRNEIQTVLEEQEGQLTYESIKAMTYLNQVISETLRLYTLVPHLERKALNDYVVPGH 392
            .:.:.|.|.|.|:|::|.:.. .:|::.:..|.|....|.|.||||..|..:.|:..:....|..
Mouse   336 THPEHQQRCREEVQSILGDGT-SVTWDHLGQMPYTTMCIKEALRLYPPVISVSRELSSPVTFPDG 399

  Fly   393 EKLVIEKGTQVIIPACAYHRDEDLYPNPETFDPERFSPEKVAARESVEWLPFGDGPRNCIGMRFG 457
            ..  |.||....|.....|.:...:|||:.|||.||:|:  ::..|..:|||..|.|||||.:|.
Mouse   400 RS--IPKGITATISIYGLHHNPRFWPNPKVFDPSRFAPD--SSHHSHAYLPFSGGSRNCIGKQFA 460

  Fly   458 QMQARIGLAQIISRFRVSVCDTTEIPLKYSPMS-IVLGTVGGIYLRVERI 506
            ..:.::.:|..:.||.: :.|.|.||:   |:: :||.:..||:|.::::
Mouse   461 MNELKVAVALTLLRFEL-LPDPTRIPV---PIARLVLKSKNGIHLCLKKL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a2NP_523628.1 p450 36..502 CDD:278495 114/434 (26%)
Cyp4a14NP_031848.1 p450 52..501 CDD:278495 114/433 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.