DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a2 and LOC105945483

DIOPT Version :9

Sequence 1:NP_523628.1 Gene:Cyp6a2 / 35587 FlyBaseID:FBgn0000473 Length:506 Species:Drosophila melanogaster
Sequence 2:XP_031756601.1 Gene:LOC105945483 / 105945483 -ID:- Length:492 Species:Xenopus tropicalis


Alignment Length:493 Identity:115/493 - (23%)
Similarity:199/493 - (40%) Gaps:95/493 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PHDAPHPLYGNMVGFRKNRVMHDF--FYDYYNKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNILI 94
            |..|..|:.||::....:..:.|.  |.:.|.       |....|....||..:...:..|.:|:
 Frog    29 PGPAAMPVLGNILQMDFSNPLKDLQKFSEVYG-------PVYSIYLGFTPAVVVRGLKSIKEVLV 86

  Fly    95 KDFSNFADRGQFHNGRDDPLTQH---LFNLDGKKWKDMRQRLTPTFTS---GKMKFMFPTVIKVS 153
            ...::||.|.|  |...|.:::.   :....|:.||:.|:....|..|   || |.|..   ::.
 Frog    87 NKGTDFAGRPQ--NRITDVISKSKGLVVAPYGQAWKEHRRFTLSTLRSFGLGK-KSMED---RIQ 145

  Fly   154 EEFVKVITEQVPAAQNGAVLEIKELMARFTTDVIGTCAFGIECNTLRTPVSD--FRTMGQKVFTD 216
            ||.:.:|  |........:.:...::....:::|.:..||     .|...:|  |:.:...|..:
 Frog   146 EENMHLI--QAFKNSKDVLFDPHFVLENAVSNIICSIVFG-----RRYDYNDTSFQNILNLVHEN 203

  Fly   217 MRHGKLLTMF------VFSFPKLASRLRMRMMP----------EDVHQFFMRLVNDTIALREREN 265
            |   ||.|.|      .|.|        ::.:|          :.|..|..::|.:     .:|.
 Frog   204 M---KLATGFWAQLYNAFGF--------IQFLPLPHKKIFQNVDVVFAFLGKVVEE-----HKET 252

  Fly   266 F---KRNDFMN-LLIELKQK-----GRVTLDNGEVIEGMDIGELAAQVFVFYVAGFETSSSTMSY 321
            .   :..|::: .|.|||:|     .::|.|.         ..|.:.|...:|||.||::|::.:
 Frog   253 LLPGEPRDYIDCYLEELKKKQEEDGNKMTFDE---------ENLFSCVADLFVAGTETTTSSLEW 308

  Fly   322 CLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYESIKAMTYLNQVISETLRLYTLVP----H--LE 380
            ||..:.:..:||::...||..|. ..:..|.||..:.|.|...|:.|..|..::||    |  :.
 Frog   309 CLLYMLKFPEIQEKCHEEIDRVF-GNKNCLEYEDRERMPYTQAVLQEVQRHASVVPLGVSHSPIR 372

  Fly   381 RKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYPNPETFDPERFSPEKVAARESVEWLPFG 445
            ...||.:.:|        |||.:|....:.|.|:..:..|..|:||.|..|.....::..:|||.
 Frog   373 DVHLNGFFIP--------KGTVIITDLSSVHYDKTHWKYPHEFNPENFLNENGELIKTEAFLPFS 429

  Fly   446 DGPRNCIGMRFGQMQARIGLAQIISRFRVSVCDTTEIP 483
            .|||.|:|....:|:..:....::..|.....|.|..|
 Frog   430 AGPRVCLGENLARMEIFLFFTAMLQHFEFHWPDPTSPP 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a2NP_523628.1 p450 36..502 CDD:278495 113/489 (23%)
LOC105945483XP_031756601.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.