DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and AAD14

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_014068.1 Gene:AAD14 / 855385 SGDID:S000005275 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:333 Identity:60/333 - (18%)
Similarity:116/333 - (34%) Gaps:104/333 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KSFE-SDAYHSTRHALDVGYRHLDTAFVYENEAE---VGQ-AISEKIAEGVVTREEVFVTTKLGG 84
            ::|| .||::      :.|...:|||..|:||..   :|: ..|.|:      |:::.:.||..|
Yeast    54 QAFELLDAFY------EAGGNCIDTANSYQNEESEIWIGEWMASRKL------RDQIVIATKFTG 106

  Fly    85 IH----------------HDPALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHNDSNVHGTLEL 133
            .:                |..:| ..:.|.||..|..:::|:..:|.                  
Yeast   107 DYKKYEVGGGKSANYCGNHKRSL-HVSVRDSLRKLQTDWIDILYIHW------------------ 152

  Fly   134 TDVDYLDTWRE----MEKLVDLGLTRSIGLSN--------------------FNAAQTERVLANC 174
              .||:.:..|    :..||..|....:|:|:                    |:..|.:..:.|.
Yeast   153 --WDYMSSIEEVMDSLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSVYQGKWNVLNR 215

  Fly   175 RIRPVVNQVECHPG-------------FQQRQLREHAKRHGLVICAYCPLARPQPARQWPPFLYD 226
            .....:..:..|.|             ||.::..|..|::|..:..:  :..|:....  .....
Yeast   216 DFERDIIPMARHFGMALAPWDVMGGGRFQSKKAMEERKKNGEGLRTF--VGGPEQTEL--EVKIS 276

  Fly   227 EHAQNLAKKYG-RTTAQICLRYL--VQLGVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYH 288
            |....:|:::| .:...|.:.|:  ....|.||........:::|......:|:|:.:..:|.  
Yeast   277 EALTKIAEEHGTESVTAIAIAYVRSKAKNVFPLIGGRKIEHLKQNIEALSIKLTPEQIEYLES-- 339

  Fly   289 TGQRTVPF 296
                .|||
Yeast   340 ----IVPF 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 60/333 (18%)
Tas 6..282 CDD:223739 56/317 (18%)
AAD14NP_014068.1 AKR_AKR9A3_9B1-4 20..338 CDD:381373 56/320 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345929
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.