DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and AAD10

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_012689.1 Gene:AAD10 / 853620 SGDID:S000003916 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:281 Identity:45/281 - (16%)
Similarity:87/281 - (30%) Gaps:89/281 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 REEVFVTTKLG-----------------GIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQK 120
            |:::.:.||..                 |.|.....|  :.|.||..|..:::|:..:|.     
Yeast     7 RDQIVIATKFTTDYKGYDVGKGKSANFCGNHKRSLHV--SVRDSLRKLQTDWIDILYVHW----- 64

  Fly   121 FHNDSNVHGTLELTDVDYLDTWRE----MEKLVDLGLTRSIGLSN-------------------- 161
                           .||:.:..|    :..||..|....:|:|:                    
Yeast    65 ---------------WDYMSSIEEVMDSLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTP 114

  Fly   162 FNAAQTERVLANCRIRPVVNQVECHPG-------------FQQRQLREHAKRHGLVICAYCPLAR 213
            |:..|.:..:.|......:..:..|.|             ||.::..|..|:.|..:..:...:.
Yeast   115 FSIYQGKWNVLNRDFERDIIPMARHFGMALAPWDVMGGGRFQSKKAVEERKKKGEGLRTFFGTSE 179

  Fly   214 PQPARQWPPFLYDEHAQNLAKKYG-RTTAQICLRYLVQLG--VVPLPKSSNKARIEENFRVFDFE 275
            .....    ....|....:|:::| .:...|.:.|:....  |.||........:::|......:
Yeast   180 QTDME----VKISEALLKVAEEHGTESVTAIAIAYVRSKAKHVFPLVGGRKIEHLKQNIEALSIK 240

  Fly   276 LSPDDVAGMEQYHTGQRTVPF 296
            |:|:.:..:|.      .|||
Yeast   241 LTPEQIKYLES------IVPF 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 45/281 (16%)
Tas 6..282 CDD:223739 41/265 (15%)
AAD10NP_012689.1 AKR_SF <1..250 CDD:412396 41/268 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345924
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.