DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and YJR096W

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_012630.1 Gene:YJR096W / 853559 SGDID:S000003857 Length:282 Species:Saccharomyces cerevisiae


Alignment Length:279 Identity:94/279 - (33%)
Similarity:145/279 - (51%) Gaps:29/279 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAE--GVV 71
            :|:||.::|::.|||:....|.........:..||||.|||.:|.||.|||..|.:.:.|  |..
Yeast     7 KLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNEDPGNH 71

  Fly    72 TREEVFVTTKLGGIHHDPALVERACRLSLSNL-GLEYVDLYLMHMPV-GQKFHNDSNVHGTLELT 134
            .|||:|.||||....:.....:.|.|..|:.: ||:|:||.|:|.|: |.|..            
Yeast    72 KREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPLEGSKLR------------ 124

  Fly   135 DVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHPGFQQRQLREH 197
                |:|||.|::.||.||.:|||:||:.....:.:|  ...:.:|||||:|..|...:::|.::
Yeast   125 ----LETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPELKHKPVVNQIEISPWIMRQELADY 185

  Fly   198 AKRHGLVICAYCPLARPQPARQWPPFLYDEHAQNLAKKYGRTTAQICLRYLVQLGVVPLPKSSNK 262
            .|..|||:.|:.||........ |..|      .:.|:..|...|:.:|:.:|.|.:||||:...
Yeast   186 CKSKGLVVEAFAPLCHGYKMTN-PDLL------KVCKEVDRNPGQVLIRWSLQHGYLPLPKTKTV 243

  Fly   263 ARIEENFRVFDFELSPDDV 281
            .|:|.|...::||||.:.:
Yeast   244 KRLEGNLAAYNFELSDEQM 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 94/279 (34%)
Tas 6..282 CDD:223739 94/279 (34%)
YJR096WNP_012630.1 AKR_AKR1-5-like 14..266 CDD:381297 91/272 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.