DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and AT1G59950

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_176203.1 Gene:AT1G59950 / 842289 AraportID:AT1G59950 Length:320 Species:Arabidopsis thaliana


Alignment Length:274 Identity:96/274 - (35%)
Similarity:153/274 - (55%) Gaps:14/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MPTLGLGTWKSFESDAY---HSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEGVV-TREEV 76
            ||.|.|||..|...:..   .:...|:.:||||.||:..|:.|..:|:|::|.::.|:: :|.|:
plant    15 MPVLALGTAASPPPEPIVLKRTVLEAIKLGYRHFDTSPRYQTEEPLGEALAEAVSLGLIQSRSEL 79

  Fly    77 FVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQ-----KFHNDSNVHGTLELTDV 136
            |||:||........||..|.:.||..|.|:|:||||:|.||..     ||..:.:     :...:
plant    80 FVTSKLWCADAHGGLVVPAIQRSLETLKLDYLDLYLIHWPVSSKPGKYKFPIEED-----DFLPM 139

  Fly   137 DYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPGFQQRQLREHAKRH 201
            ||...|.|||:...||:.:.||:|||:..:.:.:|:..:|.|.|||||..|.:|||:|||..|..
plant   140 DYETVWSEMEECQRLGVAKCIGVSNFSCKKLQHILSIAKIPPSVNQVEMSPVWQQRKLRELCKSK 204

  Fly   202 GLVICAYCPLARPQPARQWPPFLYDEHAQNLAKKYGRTTAQICLRYLVQLGVVPLPKSSNKARIE 266
            |:|:.||..|............:..:..:.:|:..|:|.||:.:|:..:.||..:.||..|.|:|
plant   205 GIVVTAYSVLGSRGAFWGTHKIMESDVLKEIAEAKGKTVAQVSMRWAYEEGVSMVVKSFRKDRLE 269

  Fly   267 ENFRVFDFELSPDD 280
            ||.::||:.|:.::
plant   270 ENLKIFDWSLTEEE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 96/274 (35%)
Tas 6..282 CDD:223739 96/274 (35%)
AT1G59950NP_176203.1 AKR_AKR4A_4B 12..293 CDD:381350 96/274 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.