DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and AT5G62420

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_201048.1 Gene:AT5G62420 / 836363 AraportID:AT5G62420 Length:316 Species:Arabidopsis thaliana


Alignment Length:323 Identity:106/323 - (32%)
Similarity:168/323 - (52%) Gaps:53/323 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RLNNGREMPTLGLGTW---KSFES--DAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAE 68
            ||..|..:|.||:||:   |..||  .|.|   .|:.:||||.|||.:|.:|..:|.|:.:.|:.
plant     7 RLRCGETIPLLGMGTYCPQKDRESTISAVH---QAIKIGYRHFDTAKIYGSEEALGTALGQAISY 68

  Fly    69 GVVTREEVFVTTKL-GGIHHDP--ALVERACRLSLSNLGLEYVDLYLMHMPVGQK---------- 120
            |.|.|:::|||:|| ...||||  ||::     :|..:||:|:|.||:|.|:..|          
plant    69 GTVQRDDLFVTSKLWSSDHHDPISALIQ-----TLKTMGLDYLDNYLVHWPIKLKPGVSEPIPKE 128

  Fly   121 --FHNDSNVHGTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPVVNQV 183
              |..|..:.           :||:.||:.:::||.||||:|||::.:...:|....:.|.||||
plant   129 DEFEKDLGIE-----------ETWQGMERCLEMGLCRSIGVSNFSSKKIFDLLDFASVSPSVNQV 182

  Fly   184 ECHPGFQQRQLREHAKRHGLVICAYCPLARPQPARQWPPFLYDEH--AQNLAKKYGRTTAQICLR 246
            |.||.::||:||:..:.:.:.:..|.||.  .|...|......||  .:::|.|:..|.||:.||
plant   183 EMHPLWRQRKLRKVCEENNIHVSGYSPLG--GPGNCWGSTAVIEHPIIKSIALKHNATPAQVALR 245

  Fly   247 YLVQLGVVPLPKSSNKARIEENFRVFDFELSPDDVAGME----------QYHTGQRTVPFSGM 299
            :.:..|...:.||.|.||:.||.|..:.:|...|::.::          .:...|.|.|:..:
plant   246 WGMSKGASVIVKSFNGARMIENKRALEIKLDDQDLSLIDHLEEWKIMRGDFLVNQTTSPYKSI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 106/320 (33%)
Tas 6..282 CDD:223739 103/294 (35%)
AT5G62420NP_201048.1 AKR_AKR4A_4B 10..288 CDD:381350 101/298 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.