DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and AKR1E2

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_011518017.1 Gene:AKR1E2 / 83592 HGNCID:23437 Length:341 Species:Homo sapiens


Alignment Length:302 Identity:113/302 - (37%)
Similarity:163/302 - (53%) Gaps:27/302 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 STRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEGVVTREEVFVTTKLGGIHHDPALVERACRL 98
            :.:.|:|.||||.|.|:.|.||.|||..|..||.||.|.||::|:.|||....|..:|||.|||.
Human    43 AVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRK 107

  Fly    99 SLSNLGLEYVDLYLMHMPVGQKFHNDSNVHGTLEL----------------------TDVDYLDT 141
            ||..|.|.|:||||:|.|:|.|..:...:....||                      :|.|:|||
Human   108 SLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDT 172

  Fly   142 WREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHPGFQQRQLREHAKRHGLV 204
            |..||.||..||.::||:||||..|.||:|  ...|.:|:.||:||||...|:.|....:...:.
Human   173 WEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVS 237

  Fly   205 ICAYCPLARPQPARQWPPFLYDEHAQNLAKKYGRTTAQICLRYLVQLGVVPLPKSSNKARIEENF 269
            :.||.||.   .:.:....:.:...:.:||::|::.|||.:|:.:|..|:.:|.|...:.|:||.
Human   238 VTAYRPLG---GSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENI 299

  Fly   270 RVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDEF 311
            :||||||:..|:..:...:...|...|.....||.|||:.|:
Human   300 QVFDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPFHIEY 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 107/287 (37%)
Tas 6..282 CDD:223739 105/271 (39%)
AKR1E2XP_011518017.1 ARA1 34..322 CDD:223729 105/281 (37%)
Tas 42..314 CDD:223739 105/273 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.