DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and AT5G01670

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_850750.1 Gene:AT5G01670 / 831701 AraportID:AT5G01670 Length:349 Species:Arabidopsis thaliana


Alignment Length:315 Identity:100/315 - (31%)
Similarity:159/315 - (50%) Gaps:33/315 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TIRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEGVV 71
            :.||.:|.::|.:|||||:|....|:......::.||||:|||:.|.::.||||.|...:..| :
plant    15 SFRLLSGHKIPAVGLGTWRSGSQAAHAVVTAIVEGGYRHIDTAWEYGDQREVGQGIKRAMHAG-L 78

  Fly    72 TREEVFVTTKL---------------------GGIHH------DPALVERACRLSLSNLGLEYVD 109
            .|.::|||:||                     |...:      .|..|..|.:.:|..|.|||:|
plant    79 ERRDLFVTSKLWYTLILRKMINLSSPLMNVLVGTCLNKRCTELSPERVRPALQNTLKELQLEYLD 143

  Fly   110 LYLMHMPVGQKFHNDSNVHGTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANC 174
            |||:|.|:..: ...|......::.|.|....|||||.|....|.|:||:.||...:..::|...
plant   144 LYLIHWPIRLR-EGASKPPKAGDVLDFDMEGVWREMENLSKDSLVRNIGVCNFTVTKLNKLLGFA 207

  Fly   175 RIRPVVNQVECHPGFQQRQLREHAKRHGLVICAYCPLARPQPARQWPPFLYDEHAQNLAKKYGRT 239
            .:.|.|.|:|.|||::..::.|..|::.:.:.||.||...:..|.   .::|:....:|||..:|
plant   208 ELIPAVCQMEMHPGWRNDRILEFCKKNEIHVTAYSPLGSQEGGRD---LIHDQTVDRIAKKLNKT 269

  Fly   240 TAQICLRYLVQLGVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTV 294
            ..||.:::.:|.|...:|||.|..||:||.:|||:.:...|...:... |.|:.|
plant   270 PGQILVKWGLQRGTSVIPKSLNPERIKENIKVFDWVIPEQDFQALNSI-TDQKRV 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 100/315 (32%)
Tas 6..282 CDD:223739 97/301 (32%)
AT5G01670NP_850750.1 ARA1 11..317 CDD:223729 97/306 (32%)
Tas 13..317 CDD:223739 97/306 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.