DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and ChlAKR

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001031505.1 Gene:ChlAKR / 818354 AraportID:AT2G37770 Length:315 Species:Arabidopsis thaliana


Alignment Length:291 Identity:116/291 - (39%)
Similarity:166/291 - (57%) Gaps:27/291 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNLAPTIRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEK 65
            |.|.....:||.|.:.|::|||||::.......:...|:.:||||:|.|.:|.||.|:|..:.:.
plant     1 MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGAVLKKL 65

  Fly    66 IAEGVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMP-------VGQKFHN 123
            ..:.||.||::|:|:||....|||..|..|...:|.:|.||||||||:|.|       ||.|..|
plant    66 FEDRVVKREDLFITSKLWCTDHDPQDVPEALNRTLKDLQLEYVDLYLIHWPARIKKGSVGIKPEN 130

  Fly   124 DSNVHGTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPG 188
                     |..||...||:.||.|.|.|..|:||:|||:..:...:|...|:.|.||||||||.
plant   131 ---------LLPVDIPSTWKAMEALYDSGKARAIGVSNFSTKKLADLLELARVPPAVNQVECHPS 186

  Fly   189 FQQRQLREHAKRHGLVICAYCPLARPQPARQWPPFLYDEHAQN-----LAKKYGRTTAQICLRYL 248
            ::|.:|:|..|..|:.:.||.||.  .|...|   |..:..:|     :|:|.|::.||:.||:.
plant   187 WRQTKLQEFCKSKGVHLSAYSPLG--SPGTTW---LKSDVLKNPILNMVAEKLGKSPAQVALRWG 246

  Fly   249 VQLGVVPLPKSSNKARIEENFRVFDFELSPD 279
            :|:|...||||:|:.||:|||.|||:.: ||
plant   247 LQMGHSVLPKSTNEGRIKENFNVFDWSI-PD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 115/289 (40%)
Tas 6..282 CDD:223739 114/286 (40%)
ChlAKRNP_001031505.1 AKR_AKR4C1-15 6..291 CDD:381351 114/286 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.