DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and Akr1c21

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_084177.2 Gene:Akr1c21 / 77337 MGIID:1924587 Length:323 Species:Mus musculus


Alignment Length:324 Identity:131/324 - (40%)
Similarity:179/324 - (55%) Gaps:14/324 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNLAPTIRLNNGREMPTLGLGTWKSFE---SDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAI 62
            |.:....:.||:|..:|.||.||....|   |.|...|:.|:|.|:.|.|:|.||..|..||:||
Mouse     1 MNSKCHCVILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAI 65

  Fly    63 SEKIAEGVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHNDS-- 125
            ..|||:|.|.||::|.|:|:......|.||..:...||..|..:||||||:|.|:..|...::  
Mouse    66 RSKIADGTVRREDIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMALKPGEENFP 130

  Fly   126 -NVHGTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHP 187
             :.||.|....||...||..|||..|.|||:|||:||||..|.|.:|  ...:.:||.|||||||
Mouse   131 VDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPGLKYKPVCNQVECHP 195

  Fly   188 GFQQRQLREHAKRHGLVICAYCPLARPQPARQW----PPFLYDEHA-QNLAKKYGRTTAQICLRY 247
            ...|.:|.:..|...:|:.||..|. .|....|    .|.|.||.. .::||||.||.|.|.|||
Mouse   196 YLNQMKLLDFCKSKDIVLVAYGVLG-TQRYGGWVDQNSPVLLDEPVLGSMAKKYNRTPALIALRY 259

  Fly   248 LVQLGVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDEF 311
            .:|.|:|.|..|..:.||:||.:||:|:||.:|:..::..:...|.:|.:...||..:||.||:
Mouse   260 QLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMRYIPAAIFKGHPNWPFLDEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 124/307 (40%)
Tas 6..282 CDD:223739 122/288 (42%)
Akr1c21NP_084177.2 AKR_AKR1C1-35 6..308 CDD:381334 123/302 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.