DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and LOC734139

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001039264.1 Gene:LOC734139 / 734139 -ID:- Length:324 Species:Xenopus tropicalis


Alignment Length:317 Identity:134/317 - (42%)
Similarity:185/317 - (58%) Gaps:14/317 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRLNNGREMPTLGLGTW---KSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEG 69
            :.|::|.:||.||.||:   ||.:..|...|:.|:||||||:|.||:|.||.|||:||..|||:|
 Frog     9 VELSDGHKMPVLGFGTYAPQKSPKHLAEEGTKVAIDVGYRHIDCAFIYGNEVEVGRAIGAKIADG 73

  Fly    70 VVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHNDS---NVHGTL 131
            .|.||:||.|.||....|.|..|......||.:|.|:|:||:::|.|:..|..:|.   :.:|.|
 Frog    74 TVKREDVFYTGKLWSSFHTPERVRVCLEKSLKDLQLDYMDLFIIHNPMEFKPGDDPLPLDENGKL 138

  Fly   132 ELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHPGFQQRQL 194
            ...:.|..|||:.:||..|.||.||||:||||..|.|.:|  ...:.:||.||||||....|.:|
 Frog   139 IYHNTDIRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECHIYLNQSKL 203

  Fly   195 REHAKRHGLVICAYCPLARPQPARQW-----PPFLYDEHAQNLAKKYGRTTAQICLRYLVQLGVV 254
            .|..|...:|:..|..|...:..| |     |..|.|.....:|||..||.||:.:|||:|.|||
 Frog   204 LEFCKSKDIVLVGYSVLGSSRDER-WIDQNSPVLLEDPVLNVIAKKLNRTPAQVAMRYLLQRGVV 267

  Fly   255 PLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDEF 311
            .|.||...|||::||:||||:|..:|:..::..:...|.|..:..|.|..|||::|:
 Frog   268 VLAKSFTPARIQQNFQVFDFQLDAEDMKSLDGLNRHLRYVDTTTWSDHPKYPFHEEY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 128/302 (42%)
Tas 6..282 CDD:223739 126/286 (44%)
LOC734139NP_001039264.1 ARA1 9..307 CDD:223729 127/298 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9378
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.