DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and AKR1D1

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_005980.1 Gene:AKR1D1 / 6718 HGNCID:388 Length:326 Species:Homo sapiens


Alignment Length:321 Identity:130/321 - (40%)
Similarity:184/321 - (57%) Gaps:21/321 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRLNNGREMPTLGLGTWKSFESD----AYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAE 68
            |.|::|..:|.:||||:...:|.    ...|.:.|:|.||||:|.|::|:||.|||:||.|||||
Human    10 IPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAE 74

  Fly    69 GVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQK-----FHNDSNVH 128
            |.|.||::|...||...:|.|.:|......:|..|.|:|||||::.:|:..|     :..|.|  
Human    75 GKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDEN-- 137

  Fly   129 GTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHPGFQQ 191
            |.......:...||..||...|.||.:|:|:||||..|.|.:|  ...:.:||.|||||||.|.|
Human   138 GKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQ 202

  Fly   192 RQLREHAKRHGLVICAYCPLARPQ-PARQW-----PPFLYDEHAQNLAKKYGRTTAQICLRYLVQ 250
            .:|.:..::|.:||.||.||...: |.  |     ||.|.|....:|.|:|.:|.|||.||:.:|
Human   203 PKLLKFCQQHDIVITAYSPLGTSRNPI--WVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQ 265

  Fly   251 LGVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDEF 311
            .|||.:|||.|..||:|||::|||.|:.:::..:|..:...|.|.......|..|||:||:
Human   266 RGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 124/306 (41%)
Tas 6..282 CDD:223739 121/290 (42%)
AKR1D1NP_005980.1 AKR_AKR1D1-3 15..322 CDD:381335 124/310 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.