DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and akr1d1

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001025609.1 Gene:akr1d1 / 594997 XenbaseID:XB-GENE-947167 Length:326 Species:Xenopus tropicalis


Alignment Length:320 Identity:130/320 - (40%)
Similarity:177/320 - (55%) Gaps:19/320 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRLNNGREMPTLGLGTWKS----FESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAE 68
            |.||:|..:|.|||||:.|    .:.....:.:.|:|:||||:|.|:||.||.||||||.|||||
 Frog    10 IPLNDGNSIPVLGLGTYSSPRTTPKGTCLEAVKLAIDLGYRHIDGAYVYYNEHEVGQAIREKIAE 74

  Fly    69 GVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQK-----FHNDSNVH 128
            |.|.||::|...||....|.|.||......:|..|.|:|||||::.:|:..|     :..|:|  
 Frog    75 GKVKREDIFYCGKLWNTCHPPELVRPTLEKTLKTLQLDYVDLYIIELPMAFKPGDEIYPRDAN-- 137

  Fly   129 GTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHPGFQQ 191
            |.......|...||..:|:..|.||.:|||:||||..|.|.:|  ...:.:|..|||||||.|.|
 Frog   138 GKYLYHKTDLCATWEALEECKDAGLVKSIGVSNFNRRQLELILNKPGLKYKPATNQVECHPYFTQ 202

  Fly   192 RQLREHAKRHGLVICAYCPLARPQPARQW-----PPFLYDEHAQNLAKKYGRTTAQICLRYLVQL 251
            .:|.|.:.:|.:|...|.|:...:. ..|     ||.|.|.....:.|||.:|.||:.||:..|.
 Frog   203 PKLLEFSGQHDIVTVGYSPIGTCRD-ETWVNVSSPPLLKDPLLNAIGKKYNKTAAQVALRFNAQR 266

  Fly   252 GVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDEF 311
            ||..:|||.|..||:|||::|||.|:..::..:|..:...|.|.....|.|..|||.||:
 Frog   267 GVAVIPKSFNPDRIKENFQIFDFSLTDKEMKDIEALNKNVRYVELLMWSDHPEYPFKDEY 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 123/305 (40%)
Tas 6..282 CDD:223739 120/289 (42%)
akr1d1NP_001025609.1 ARA1 9..309 CDD:223729 122/301 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9378
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.