DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and Akr1a1

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_067448.1 Gene:Akr1a1 / 58810 MGIID:1929955 Length:325 Species:Mus musculus


Alignment Length:323 Identity:137/323 - (42%)
Similarity:191/323 - (59%) Gaps:16/323 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 APTIRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEG 69
            |.::.|:.|::||.:|||||||.......:.:|||..||||:|.|.||.||.|:|:|:.|.:..|
Mouse     3 ASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKHALSAGYRHIDCASVYGNETEIGEALKESVGSG 67

  Fly    70 -VVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVG-QKFHN--DSNVHGT 130
             .|.|||:|||:||....|.|..||.|.|.:|::|.|||:||||||.|.. ::..|  ..|..||
Mouse    68 KAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGT 132

  Fly   131 LELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPGFQQRQLR 195
            :......|.:||:.:|.||..||.:::||||||:.|.:.||:...:||.|.||||||...|.:|.
Mouse   133 VRYDSTHYKETWKALEVLVAKGLVKALGLSNFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELI 197

  Fly   196 EHAKRHGLVICAYCPLARPQPARQWP--PFLYDEH-AQNLAKKYGRTTAQICLRYLVQLGVVPLP 257
            .|....||.:.||.||.....|.:.|  |.|.:|. ...||:|:||:.|||.||:.||..|:.:|
Mouse   198 AHCHARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIP 262

  Fly   258 KSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQR-TVPFSGM--------SGHKYYPFNDEF 311
            ||.|.:||.:|.:||||..||:::..::..:...| .||...:        :||..|||||.:
Mouse   263 KSINPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 130/300 (43%)
Tas 6..282 CDD:223739 126/282 (45%)
Akr1a1NP_067448.1 ARA1 1..303 CDD:223729 130/299 (43%)
Tas 9..291 CDD:223739 125/281 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.720

Return to query results.
Submit another query.