DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and AKR1B10

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_064695.3 Gene:AKR1B10 / 57016 HGNCID:382 Length:316 Species:Homo sapiens


Alignment Length:322 Identity:124/322 - (38%)
Similarity:184/322 - (57%) Gaps:20/322 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LAPTIRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAE 68
            :|..:.|:...:||.:|||||||.......:.:.|:|.||||:|.|:||:||.|||:||.|||.|
Human     1 MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKIQE 65

  Fly    69 GVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHND-------SN 126
            ..|.||::|:.:||.....:..||.:|...:|.:|.|.|:|:||:|.|.|.|..:|       .|
Human    66 KAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGN 130

  Fly   127 VHGTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHPGF 189
            ..|    ....:||.|..||:|||.||.:::|:|||:..|.|::|  ...:.:||.|||||||..
Human   131 AIG----GKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKPVTNQVECHPYL 191

  Fly   190 QQRQLREHAKRHGLVICAYCPLARPQPARQW-----PPFLYDEHAQNLAKKYGRTTAQICLRYLV 249
            .|.:|.::....|:.:.||.||..|.  |.|     |..|.|...:.:|.|:.:|.||:.:|:.:
Human   192 TQEKLIQYCHSKGITVTAYSPLGSPD--RPWAKPEDPSLLEDPKIKEIAAKHKKTAAQVLIRFHI 254

  Fly   250 QLGVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDEF 311
            |..|:.:|||...|||.||.:||||:||.:::|.:..::...|.......|..:.||||.|:
Human   255 QRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACNVLQSSHLEDYPFNAEY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 118/307 (38%)
Tas 6..282 CDD:223739 115/289 (40%)
AKR1B10NP_064695.3 AKR_AKR1B1-19 10..316 CDD:381333 121/311 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.