DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and Akr1e1

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_061347.2 Gene:Akr1e1 / 56043 MGIID:1914758 Length:301 Species:Mus musculus


Alignment Length:302 Identity:119/302 - (39%)
Similarity:182/302 - (60%) Gaps:10/302 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEGVVTREEVFVTT 80
            :||:||||||:...:...:.:.|:::||||.|.|::|.||:|||..|||||.||||.||::||.:
Mouse     4 IPTVGLGTWKASPGEVTDAVKLAINLGYRHFDCAYLYHNESEVGMGISEKIKEGVVKREDLFVVS 68

  Fly    81 KLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHNDSNV----HGTLELTDVDYLDT 141
            ||....|..:||:.||..:|..|.|:|:||||:|.|:|.| ..:.::    :|.:..:...:|||
Mouse    69 KLWCTCHKKSLVKTACTNTLEALNLDYLDLYLIHWPMGFK-PGEKDIPLDRNGKVIPSHTSFLDT 132

  Fly   142 WREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHPGFQQRQLREHAKRHGLV 204
            |..||.||..||.:::|:||||..|.||:|  ...|:||:.||:||||...|::|.:...:..:.
Mouse   133 WEAMEDLVFEGLVKNLGVSNFNHEQLERLLDKPGLRVRPITNQIECHPYLNQKKLIDFCHKRNVS 197

  Fly   205 ICAYCPLARPQPARQWPPFLYDEHAQNLAKKYGRTTAQICLRYLVQLGVVPLPKSSNKARIEENF 269
            :.||.||........   .:.|...:.:|||:|::.|||.:|:.:|..::.:|||...:||.||.
Mouse   198 VTAYRPLGGSGGGFH---LMDDTVIRKIAKKHGKSPAQILIRFQIQRNLIVIPKSVTPSRIRENI 259

  Fly   270 RVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDEF 311
            :||||||:..|:..:.......|...|.....|:.|||:.|:
Mouse   260 QVFDFELTEKDMEELLSLDKNLRLATFPTTENHQDYPFHIEY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 114/287 (40%)
Tas 6..282 CDD:223739 112/271 (41%)
Akr1e1NP_061347.2 Tas 4..287 CDD:223739 113/286 (40%)
ARA1 4..282 CDD:223729 112/281 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.