DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and akr1a1

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001016137.1 Gene:akr1a1 / 548891 XenbaseID:XB-GENE-1014353 Length:327 Species:Xenopus tropicalis


Alignment Length:320 Identity:139/320 - (43%)
Similarity:189/320 - (59%) Gaps:20/320 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKI-AEGVVTR 73
            |..|:::|.:|||||||.......:.::||.|||||:|.||||.||.|||:||.|.: ::..::|
 Frog    10 LYTGQKIPLIGLGTWKSAPGQVKDAVKYALGVGYRHIDCAFVYGNETEVGEAIKESVGSDKGLSR 74

  Fly    74 EEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHND---SNVHGTLELTD 135
            ||||||:||....|.|..||.|.|.:|.:|.|:|:||||||.|...|..:.   .|..|:::...
 Frog    75 EEVFVTSKLWNNKHHPDDVECALRKTLQDLQLDYLDLYLMHWPYAFKRGDQIFPQNPDGSVQYDL 139

  Fly   136 VDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPGFQQRQLREHAKR 200
            .||.|||:.|||||..|||::|||||||..|.:.:::...::|.|.||||||...|.:|..:...
 Frog   140 TDYKDTWKAMEKLVKQGLTKAIGLSNFNKRQIDDIISIATVKPAVLQVECHPYLAQNELIAYCHA 204

  Fly   201 HGLVICAYCPLARPQPARQW-----PPFLYDEHAQNLAKKYGRTTAQICLRYLVQLGVVPLPKSS 260
            ||||...|.||..|.  |.|     |..|.:.....:|||||::.|||.||:.||..||.:|||.
 Frog   205 HGLVFTGYSPLGSPD--RSWRKPEDPVLLEEPGIIAMAKKYGKSEAQILLRWQVQRKVVSIPKSV 267

  Fly   261 NKARIEENFRVFDFELSPDDVAGMEQYHTGQR----TVPFSGMS-----GHKYYPFNDEF 311
            ...||.:||:||||.||.:::..:...:...|    .:..:|.|     ||..|||||.:
 Frog   268 TPTRILQNFQVFDFSLSEEEMQLIGALNKNWRYIIPLITVNGKSVPRDAGHPLYPFNDPY 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 130/300 (43%)
Tas 6..282 CDD:223739 129/280 (46%)
akr1a1NP_001016137.1 AKR_AKR1A1-4 10..314 CDD:381332 132/305 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.