DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and Akr1c12l1

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001129216.1 Gene:Akr1c12l1 / 498790 RGDID:1559604 Length:323 Species:Rattus norvegicus


Alignment Length:323 Identity:135/323 - (41%)
Similarity:186/323 - (57%) Gaps:26/323 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRLNNGREMPTLGLGTW------KSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKI 66
            ::||:|..:|.||.||.      ||...:|.|.   |:|.||.|:|||..|:.|.|:||||..||
  Rat     8 VKLNDGHFIPALGFGTSIPNEVPKSKSLEAVHL---AIDAGYHHIDTASAYQIEEEIGQAIQSKI 69

  Fly    67 AEGVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPV----GQKF--HNDS 125
            ..|||.||::|:||||......|.||:.|...||.||.|:|.|||:||.||    |.|:  .:|.
  Rat    70 KAGVVKREDMFITTKLWCTCFRPELVKPALEKSLKNLQLDYADLYIMHYPVPMKSGDKYLPVDDK 134

  Fly   126 NVHGTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHPG 188
               |...|..||:.|||..:||..|.||.:|||:||||..|.||:|  ...:.:||.||||||..
  Rat   135 ---GKWLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVECHLY 196

  Fly   189 FQQRQLREHAKRHGLVICAYCPLARPQPARQW-----PPFLYDEHAQNLAKKYGRTTAQICLRYL 248
            ..|.:|.::.|...:|:.||..|. .|..::|     |..|.|....::|||..|:.|.|.||||
  Rat   197 MNQSKLLDYCKSKDIVLVAYGALG-TQRYKEWVDQNSPVLLDDPVLCDVAKKNKRSPALIALRYL 260

  Fly   249 VQLGVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDEF 311
            ||..||||.:|..:..:.||.:||:|:|||:|:..::..:...|.:....::||..|||::|:
  Rat   261 VQREVVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLSAEFLAGHPEYPFSEEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 129/308 (42%)
Tas 6..282 CDD:223739 128/292 (44%)
Akr1c12l1NP_001129216.1 ARA1 8..305 CDD:223729 128/303 (42%)
Tas 16..297 CDD:223739 125/287 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.