DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and RGD1564865

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001157868.1 Gene:RGD1564865 / 498789 RGDID:1564865 Length:323 Species:Rattus norvegicus


Alignment Length:319 Identity:131/319 - (41%)
Similarity:186/319 - (58%) Gaps:18/319 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRLNNGREMPTLGLGTWKSFE---SDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEG 69
            :.|::||.||.||.||:::.|   |....||:.|:|:|:||:|:|:||:||.|||:||..||..|
  Rat     8 VELSDGRLMPLLGYGTFQNPEIPASKILESTKIAIDIGFRHIDSAYVYKNEKEVGEAIRSKITGG 72

  Fly    70 VVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQK-----FHNDSNVHG 129
            ||.||::|:||||....|.|.||......||.:..|:||||||:|.|:..|     :..|.|  |
  Rat    73 VVKREDIFLTTKLWSTFHRPELVRVGLERSLKSFQLDYVDLYLIHYPISIKPSEEIYTKDEN--G 135

  Fly   130 TLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHPGFQQR 192
            .:....||....|..|||..|.||.:|||:||||..|.|.:|  ...:.|||.|||||||...|.
  Rat   136 KILFETVDLCAIWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKHRPVCNQVECHPYLNQS 200

  Fly   193 QLREHAKRHGLVICAYCPLARPQPARQW----PPFLY-DEHAQNLAKKYGRTTAQICLRYLVQLG 252
            :|.:..|...:|:.||..|...:|. .|    .|||. |.....:|||:.|:.|||.|||.||.|
  Rat   201 KLMDFCKSQDIVLVAYAALGSQRPT-NWVDKNAPFLLNDPVLGGMAKKHNRSPAQIALRYQVQRG 264

  Fly   253 VVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDEF 311
            ||.|.::..:..::||.:||:|:|..:|:..::..:...|..|.:..:.|..||::|::
  Rat   265 VVALAQTYEQKEMKENIQVFEFQLPSEDMEVLDGLNRNFRYFPVNIAAEHPNYPYSDDY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 127/304 (42%)
Tas 6..282 CDD:223739 125/288 (43%)
RGD1564865NP_001157868.1 ARA1 8..311 CDD:223729 127/305 (42%)
Tas 19..297 CDD:223739 120/280 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.