DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and akr1b1

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001011130.1 Gene:akr1b1 / 496546 XenbaseID:XB-GENE-5821742 Length:318 Species:Xenopus tropicalis


Alignment Length:316 Identity:139/316 - (43%)
Similarity:199/316 - (62%) Gaps:17/316 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PT-IRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEG 69
            || ::|..|.:||.:|||||||.......:...|::|||||||.|:||:||.|||:.|.:||.||
 Frog     4 PTHVQLYTGAQMPIVGLGTWKSEPGKVTAAVAKAIEVGYRHLDCAYVYQNENEVGEGIQQKIKEG 68

  Fly    70 VVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQK-----FHNDSNVHG 129
            :|.||::||.:||....||.::|:.||:.:||:|.|:|:||||:|.|.|.:     |..|:  .|
 Frog    69 LVKREDLFVVSKLWSTFHDKSMVKGACQKTLSDLKLDYLDLYLVHWPTGFQAGDALFPLDN--EG 131

  Fly   130 TLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHPGFQQR 192
            .:..::..:||||..||:|||.||.::||:||||..|.|::|  ...:.:|.|:|.||||...|:
 Frog   132 CVIHSNTHFLDTWEGMEELVDAGLVKAIGISNFNREQIEQLLNKPGLKHKPAVHQFECHPYLTQK 196

  Fly   193 QLREHAKRHGLVICAYCPLARPQPARQW-----PPFLYDEHAQNLAKKYGRTTAQICLRYLVQLG 252
            :|.:..:..|:|:.||.||..|.  |.|     |..|.:...:.:||||.:|:||:.:|:.:|..
 Frog   197 KLIDLCQSKGIVVTAYSPLGSPD--RPWAKPEDPSLLEEPKIKEIAKKYNKTSAQVLIRFHIQRN 259

  Fly   253 VVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFN 308
            ||.:|||...|||||||:||||||||:|...:..:..|.|....|....||.|||:
 Frog   260 VVVIPKSVTPARIEENFQVFDFELSPEDTEAIFSFERGWRVCALSSAKKHKDYPFH 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 133/304 (44%)
Tas 6..282 CDD:223739 131/288 (45%)
akr1b1NP_001011130.1 AKR_AKR1B1-19 12..318 CDD:381333 136/308 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.