DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and zgc:101765

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001006056.1 Gene:zgc:101765 / 450036 ZFINID:ZDB-GENE-041010-156 Length:288 Species:Danio rerio


Alignment Length:299 Identity:108/299 - (36%)
Similarity:160/299 - (53%) Gaps:27/299 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNLAPTIRLNNGREMPTLGLGTWK-SFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISE 64
            ||:..|::.|||..:||.|||||:: ..:.|.|.:...||..|||..|||.||.|||.:|.|:..
Zfish     1 MTDPQPSVLLNNDIQMPLLGLGTFRLQGQEDTYSAVDAALKAGYRAFDTAAVYRNEAHLGHALRC 65

  Fly    65 KIAEGVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMH------MPVGQKFHN 123
            .:.:..::||:||:|:|||. ....:.....|:.||..|||.|:||||:|      :|||.|.:.
Zfish    66 LLPKHGLSREDVFITSKLGP-KDQGSKARNGCQKSLEQLGLGYIDLYLIHWPGTQGLPVGDKRNP 129

  Fly   124 DSNVHGTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPG 188
            ::..            .:||.:|:....|..|:||:||:.....:.:|.:|::.|.|.|||.||.
Zfish   130 ENRA------------QSWRVLEEFYSEGKFRAIGVSNYTVEHMQELLKSCKVPPAVLQVEFHPK 182

  Fly   189 FQQRQLREHAKRHGLVICAYCPLARPQPARQWPPFLYDEHAQNLAKKYGRTTAQICLRYLVQLGV 253
            ..|..||...|..|:...||..|....       .|.:.....:||:.|||.||:.||:.||..:
Zfish   183 LLQNDLRGLCKIRGVCFQAYSSLGTGL-------LLSNPVVLEIAKECGRTPAQVLLRWAVQQSI 240

  Fly   254 VPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQR 292
            ..|||||...|::||.|:||||:|.:|:..:.....|::
Zfish   241 AVLPKSSQPERVKENGRLFDFEISEEDMERLSALDCGEK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 106/297 (36%)
Tas 6..282 CDD:223739 105/282 (37%)
zgc:101765NP_001006056.1 ARA1 5..283 CDD:223729 106/295 (36%)
Tas 11..271 CDD:223739 103/279 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594357
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.670

Return to query results.
Submit another query.