DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and CG18547

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster


Alignment Length:251 Identity:63/251 - (25%)
Similarity:91/251 - (36%) Gaps:70/251 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 STRHALDVGYRHLDTAFVYENEAEVGQAISEKI---AEGVVTREEVFVTTKLGGIHHD------- 88
            :...|:..|..::|||..|      ||..||::   |...|.||..::.||:.....|       
  Fly    58 TVHEAVKSGINYIDTAPWY------GQGRSEEVLGLALKDVPRESYYIATKVARYELDYDKMFDF 116

  Fly    89 -PALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHNDSNVHGTLELTDVDYLDTWREMEKLVDLG 152
             ......:...||..|||:|||:..:|   ..:|..|         .|:...:|...:|:||..|
  Fly   117 SAKKTRESVEKSLKLLGLDYVDVIQIH---DIEFAKD---------LDIVINETLPTLEQLVKEG 169

  Fly   153 LTRSIGLSNF-----------NAAQTERVLANCRIRPVVNQVECHPGFQQRQLREHA---KRHGL 203
            ..|.||:|.:           .|.:.:.||...|..           .....|.|:.   |...|
  Fly   170 KARFIGVSAYPISVLKEFLTRTAGRLDTVLTYARYT-----------LTDETLLEYLDFFKSQNL 223

  Fly   204 -VICAYCPL------ARPQPARQWPPFLYDEHAQNLAKKYGRTTAQICLRYLVQLG 252
             ||||....      |.|||   |.|      |.:..|...|..:::|....|:||
  Fly   224 GVICAAAHALGLLTNAGPQP---WHP------ASDEQKAIARKASEVCKERGVELG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 63/251 (25%)
Tas 6..282 CDD:223739 63/251 (25%)
CG18547NP_650138.1 Tas 22..331 CDD:223739 63/251 (25%)
Aldo_ket_red 24..321 CDD:294321 63/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468232
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.