DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and CG2767

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster


Alignment Length:322 Identity:118/322 - (36%)
Similarity:182/322 - (56%) Gaps:19/322 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEGVVT 72
            :..|||.:||.:|:|||::.:.:...:...||:.||||:|||.||.||..:|:.:...:..|.|.
  Fly     7 LTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK 71

  Fly    73 REEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHNDSNV----HGTLEL 133
            |||:|:.||:..:.:.|..||...:.||.:|.|:||||||:|.|.....:.|.:.    .|.:|:
  Fly    72 REELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEV 136

  Fly   134 TDV--DYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPGFQQRQLRE 196
             ||  ::...|..||.||:.|||:|||:|||:..|..|:|.||:|||..||:|.|...|||.|.:
  Fly   137 -DVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLVD 200

  Fly   197 HAKRHGLVICAYCPLARPQPA---------RQWPPFLYDEHAQNLAKKYGRTTAQICLRYLVQLG 252
            ..|...:.:.||.||.....|         |..|..:.....:.:|..:|:|.||:.||:::..|
  Fly   201 FCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTG 265

  Fly   253 VVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFS---GMSGHKYYPFNDEF 311
            |..:|||:|.||:::|..||||||:.::||.:.......|...|:   |:..|..:.|.:::
  Fly   266 VSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQY 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 115/307 (37%)
Tas 6..282 CDD:223739 111/288 (39%)
CG2767NP_649757.1 ARA1 5..302 CDD:223729 113/295 (38%)
Tas 10..297 CDD:223739 113/287 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 135 1.000 Domainoid score I232
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm51343
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
87.920

Return to query results.
Submit another query.