DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and Akr1B

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster


Alignment Length:318 Identity:140/318 - (44%)
Similarity:193/318 - (60%) Gaps:15/318 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 APTIRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEG 69
            ||.:...:|.|:|.:||||:.|.:.....:.:.|:|.||||:|.|:||:||.|||..:..||.||
  Fly    37 APKVVCLDGNEIPVIGLGTFNSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEG 101

  Fly    70 VVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQK-----FHNDSNVHG 129
            ||.||::|:|:||....|.|.||:.|...:||:|.|:|:||||:|.|:|.|     |..|.:  |
  Fly   102 VVKREDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDKD--G 164

  Fly   130 TLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPGFQQRQL 194
            ....:.|||:|||:.|||||:.||.:|||:||||..|.||||....|.||.||:||||...|::|
  Fly   165 KTLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIPPVTNQIECHPYLTQKKL 229

  Fly   195 REHAKRHGLVICAYCPLARPQPARQW-----PPFLYDEHAQNLAKKYGRTTAQICLRYLVQLGVV 254
            .:..|...:.|.||.||..|.  |.|     |..|.:...:.:|.|..:|..||.:||.||...:
  Fly   230 IDFCKSKDITITAYSPLGSPN--RPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRANI 292

  Fly   255 PLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPF-NDEF 311
            .:|||..|.|||.||:||||||:|:::..:|.:....|.||.....||.::|| .||:
  Fly   293 VIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPLLNQYGHPHHPFEKDEY 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 134/302 (44%)
Tas 6..282 CDD:223739 129/285 (45%)
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 128/281 (46%)
Tas 45..>248 CDD:223739 98/204 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468220
Domainoid 1 1.000 135 1.000 Domainoid score I232
eggNOG 1 0.900 - - E1_COG0656
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm1169
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
1110.780

Return to query results.
Submit another query.