DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and Akr1c12

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001014262.3 Gene:Akr1c12 / 364773 RGDID:1359406 Length:323 Species:Rattus norvegicus


Alignment Length:324 Identity:132/324 - (40%)
Similarity:188/324 - (58%) Gaps:14/324 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNLAPTIRLNNGREMPTLGLGTWKSFE---SDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAI 62
            |::....::||:|..:|.||.||:|..|   |.:..:...|:||||||:|||..|:.|.|:||||
  Rat     1 MSSKLHCVKLNDGHFIPALGFGTYKPKEVPKSKSLEAAHLAIDVGYRHIDTASAYQVEEEIGQAI 65

  Fly    63 SEKIAEGVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHNDS-- 125
            ..||..|||.|:::|:||||........:|..|...||.||.|:||||:|:|.||..|...|.  
  Rat    66 QSKIKAGVVKRKDMFITTKLWCSCFRTEMVRPALEKSLKNLQLDYVDLFLIHYPVPIKSSVDESP 130

  Fly   126 -NVHGTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHP 187
             :..|...|..||:.|||..:||..|.||.:|||:||||..|.||:|  ...:.:||.||||||.
  Rat   131 LDEKGKFLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVECHL 195

  Fly   188 GFQQRQLREHAKRHGLVICAYCPLARPQPARQW-----PPFLYDEHAQNLAKKYGRTTAQICLRY 247
            ...|.:|.::.|...:|:.||..|. .|..::|     |..|.|....::|||..|:.|.|.|||
  Rat   196 YLNQSKLLDYCKSKDIVLVAYGALG-TQRYKEWVDQNSPVLLDDPILCDVAKKNKRSPALIALRY 259

  Fly   248 LVQLGVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDEF 311
            |.|.|||||.:|..:..:.||.:||:|:|||:|:..::..:...|.:....::.|..|||::|:
  Rat   260 LFQRGVVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLSAEFLADHPEYPFSEEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 126/307 (41%)
Tas 6..282 CDD:223739 125/288 (43%)
Akr1c12NP_001014262.3 ARA1 8..305 CDD:223729 125/297 (42%)
Tas 16..297 CDD:223739 122/281 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.