DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and Gclm

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_059001.1 Gene:Gclm / 29739 RGDID:619871 Length:274 Species:Rattus norvegicus


Alignment Length:135 Identity:38/135 - (28%)
Similarity:62/135 - (45%) Gaps:23/135 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EAEVGQAISEKIAEGVVTREEVFVTTKLGGIHHDPA-----LVERACRLSLSNLGLEYVDLYLMH 114
            |..:..|: |||...  .|||:.|:.||..:..:.:     .|:.||    |.||:..:|..:|.
  Rat    71 ECTMSHAV-EKINPD--EREEMKVSAKLFIVGSNSSSSTRNAVDMAC----SVLGVAQLDSVIMA 128

  Fly   115 MPVGQKFHNDSNVHGTLELTDVDYLDT-WREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRP 178
            .|     ..:..|:.:||     :|.. |.|:|.||......:||.|:.:..|.|::....:::|
  Rat   129 SP-----PIEDGVNLSLE-----HLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVKP 183

  Fly   179 VVNQV 183
            ..|||
  Rat   184 NSNQV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 38/135 (28%)
Tas 6..282 CDD:223739 38/135 (28%)
GclmNP_059001.1 AKR_SF <86..>211 CDD:412396 33/117 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.