DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and SPAC26F1.07

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_594888.1 Gene:SPAC26F1.07 / 2542088 PomBaseID:SPAC26F1.07 Length:321 Species:Schizosaccharomyces pombe


Alignment Length:281 Identity:101/281 - (35%)
Similarity:153/281 - (54%) Gaps:17/281 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEGVVTRE 74
            |.:|.::|.||||||:|..:...::.:.||..||||:|.|.:|.||.|||..|.    |..|.|:
pombe    18 LADGSKIPGLGLGTWRSEPNQTKNAVKTALQYGYRHIDAAAIYGNEDEVGDGIK----ESGVPRK 78

  Fly    75 EVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVG-----QKFHNDSNVHGTLELT 134
            :::||:||....|.|..|.:|...:|.:|.|:|:|.||:|.||.     .||..|.:.:...|..
pombe    79 DIWVTSKLWCNAHAPEAVPKALEKTLKDLKLDYLDEYLIHWPVSFKTGEDKFPKDKDGNLIYEKN 143

  Fly   135 DVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPGFQQRQLREHAK 199
            .::  :||:.||||::.|..|.|||||||....||:|...:::|.|:|:|.||...|.:..|..|
pombe   144 PIE--ETWKAMEKLLETGKVRHIGLSNFNDTNLERILKVAKVKPAVHQMELHPFLPQTEFVEKHK 206

  Fly   200 RHGLVICAYCPLARPQP--ARQWPPFLYDEHAQNLAKKYGR--TTAQICLRYLVQLGVVPLPKSS 260
            :.|:.:.||.|......  ..:.|..:..|..|.:||..|.  |.|.|.:.:.:..|...:|||.
pombe   207 KLGIHVTAYSPFGNQNTIYESKIPKLIEHETIQKIAKSKGEGVTGATIAVSWAITRGTSVIPKSV 271

  Fly   261 NKARIEENFRVFDFELSPDDV 281
            |:.||:.||:.  ..|:.:|:
pombe   272 NEQRIKSNFKY--IPLTKEDM 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 101/281 (36%)
Tas 6..282 CDD:223739 101/281 (36%)
SPAC26F1.07NP_594888.1 ARA1 15..302 CDD:223729 101/281 (36%)
Tas 21..303 CDD:223739 100/278 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9270
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
TreeFam 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.