DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and SPBC8E4.04

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_596843.1 Gene:SPBC8E4.04 / 2541256 PomBaseID:SPBC8E4.04 Length:325 Species:Schizosaccharomyces pombe


Alignment Length:274 Identity:100/274 - (36%)
Similarity:145/274 - (52%) Gaps:25/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEGVVTRE 74
            |.||.::|::|||||:|.:.:..::...||..||||:|||.:|.||.|:|    |.|.|..|.|.
pombe    17 LPNGDKIPSIGLGTWRSGKDETKNAVCAALKAGYRHIDTAHIYGNEKEIG----EGIRESGVPRT 77

  Fly    75 EVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHNDS---NVHGTLELTDV 136
            :::||:||....|...||..|...:|.:|.|||:|.||:|.|.......:.   |..|.|...||
pombe    78 DIWVTSKLWCNAHRAGLVPLALEKTLQDLNLEYIDAYLIHWPFALLSGPEELPRNEKGELIYEDV 142

  Fly   137 DYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPGFQQRQLREHAKRH 201
            ...:||:.||:|::.|..|.||:||||....:|||...:::|.::|:|.||...|.:..|..|:.
pombe   143 PIEETWQAMEELLETGKVRYIGISNFNNEYLDRVLKIAKVKPTIHQMELHPYLPQTEYLEKHKKL 207

  Fly   202 GLVICAYCPLARPQPARQWPPFLYDEHAQNL-----------AKKYGRTTAQICLRYLVQLGVVP 255
            .:.:.||.|||....|       |:.....|           |:..|.|.|.|.:.:.|:.|...
pombe   208 QIHVSAYSPLANQNDA-------YNSDISKLIEHKTLVDIANARGEGITPANIAISWAVKRGTSV 265

  Fly   256 LPKSSNKARIEENF 269
            ||||.|::||..||
pombe   266 LPKSVNESRIVSNF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 100/274 (36%)
Tas 6..282 CDD:223739 100/274 (36%)
SPBC8E4.04NP_596843.1 ARA1 12..314 CDD:223729 100/274 (36%)
Tas 13..293 CDD:223739 100/274 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9270
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
TreeFam 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.