DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and AKR1B1

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001619.1 Gene:AKR1B1 / 231 HGNCID:381 Length:316 Species:Homo sapiens


Alignment Length:320 Identity:142/320 - (44%)
Similarity:198/320 - (61%) Gaps:16/320 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LAPTIRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAE 68
            :|..:.||||.:||.||||||||.......:.:.|:||||||:|.|.||:||.|||.||.||:.|
Human     1 MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLRE 65

  Fly    69 GVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQK-----FHNDSNVH 128
            .||.|||:|:.:||...:|:..||:.||:.:||:|.|:|:||||:|.|.|.|     |..|.:  
Human    66 QVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDES-- 128

  Fly   129 GTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHPGFQQ 191
            |.:..:|.:.||||..||:|||.||.::||:||||..|.|.:|  ...:.:|.|||:||||...|
Human   129 GNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQ 193

  Fly   192 RQLREHAKRHGLVICAYCPLARPQPARQW-----PPFLYDEHAQNLAKKYGRTTAQICLRYLVQL 251
            .:|.::.:..|:|:.||.||..|.  |.|     |..|.|...:.:|.|:.:||||:.:|:.:|.
Human   194 EKLIQYCQSKGIVVTAYSPLGSPD--RPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQR 256

  Fly   252 GVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDEF 311
            .:|.:|||....||.|||:|||||||..|:..:..|:...|.......:.||.|||::||
Human   257 NLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 135/305 (44%)
Tas 6..282 CDD:223739 132/287 (46%)
AKR1B1NP_001619.1 AKR_AKR1B1-19 10..316 CDD:381333 136/309 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.