DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and F53F1.3

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_506323.1 Gene:F53F1.3 / 186169 WormBaseID:WBGene00009981 Length:283 Species:Caenorhabditis elegans


Alignment Length:268 Identity:85/268 - (31%)
Similarity:130/268 - (48%) Gaps:20/268 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TIRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEGVV 71
            :|:||.|.:.|.:||||:|............||..|||..|||.||.||.|:|.|:...:.:..:
 Worm     2 SIKLNTGYDCPLIGLGTYKIIGDQVLPVLDAALTAGYRLFDTAKVYNNEKEIGDALEILLPKHNL 66

  Fly    72 TREEVFVTTKLGGIHHDPALVERACRL---SLSNLGLEYVDLYLMHMPVGQKFHNDSNVHGTLEL 133
            .||::|:|||:     .|..||...:|   |||.|...|:|:||:|.|....:.:...::.||.:
 Worm    67 KREDIFITTKM-----HPNTVENVKKLVDESLSLLKTSYIDMYLIHYPKSFDYGDQDPMNKTLRI 126

  Fly   134 TDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL-ANCRIRPVVNQVECHPGFQQRQLREH 197
            .      ||.::.:..:.|..||:|:|:|.....|.:. ......|..||||.||.|.:.:|:.:
 Worm   127 A------TWNDLWECKNAGKIRSVGVSSFEIRHLEELKDLGKNFPPCCNQVEYHPHFTREELKNY 185

  Fly   198 AKRHGLVICAYCPLARPQPARQWPPFLYDEHAQNLAKKYGRTTAQICLRYLVQLGVVPLPKSSNK 262
            .|..|:...|:..|||....     .|..|....||:||......:.|.:.....|..:|||:|.
 Worm   186 CKSEGIFFQAFSSLARHNET-----LLSSEIITRLAEKYHVPKTTVLLSWATSQKVGIIPKSTNP 245

  Fly   263 ARIEENFR 270
            .|:.:|.:
 Worm   246 ERLAQNLK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 85/268 (32%)
Tas 6..282 CDD:223739 85/268 (32%)
F53F1.3NP_506323.1 AKR_AKR1-5-like 12..265 CDD:381297 81/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166063
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.