DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and C56G3.2

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001367459.1 Gene:C56G3.2 / 183870 WormBaseID:WBGene00016985 Length:131 Species:Caenorhabditis elegans


Alignment Length:78 Identity:29/78 - (37%)
Similarity:41/78 - (52%) Gaps:7/78 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 PALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHNDSNVHGTLELTDVDYLDTWREMEKLVDLGL 153
            |..:|.|.|.||..|.||||||||.|||..........:..::|       |.||:.:.:...||
 Worm    59 PGRLEGALRDSLKKLHLEYVDLYLAHMPTAFSDDMSQKIESSVE-------DIWRQFDAVYKAGL 116

  Fly   154 TRSIGLSNFNAAQ 166
            .:::|:||:|..|
 Worm   117 AKAVGVSNWNNDQ 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 29/78 (37%)
Tas 6..282 CDD:223739 29/78 (37%)
C56G3.2NP_001367459.1 AKR_SF <51..>131 CDD:412396 29/78 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166095
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.