DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and ZC443.1

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_506205.1 Gene:ZC443.1 / 179756 WormBaseID:WBGene00013896 Length:320 Species:Caenorhabditis elegans


Alignment Length:326 Identity:120/326 - (36%)
Similarity:188/326 - (57%) Gaps:29/326 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNLAPTIRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEK 65
            |::..|...|:||..||::|||||:....:.....|:|:..||||:|||.:|:||.::|.|::|.
 Worm     1 MSSKVPIFTLSNGVLMPSIGLGTWQMTGEEGKTVIRNAVLAGYRHIDTATLYQNEHQIGDALAEL 65

  Fly    66 IAEGVVTREEVFVTTKLGGIHHD--PALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHNDSNVH 128
            .|||::.||::|:|||  ...|:  |.:||.|.|.||..|.|:||||||.|:|...|  :|.:..
 Worm    66 FAEGILKREDIFITTK--AFCHEVAPDVVEEALRNSLKRLRLDYVDLYLAHIPASTK--DDGSFR 126

  Fly   129 GTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPV-VNQVECHPGFQQR 192
                 :||...|.||..||:..||||::||:||||.:|..|:: |.:..|: .:|:|.|....|:
 Worm   127 -----SDVKVEDIWRGFEKVYGLGLTKAIGVSNFNESQIVRIM-NIQKVPIHASQLELHLYLPQK 185

  Fly   193 QLREHAKRHGLVICAYCPLARP--------------QPARQWPPFLYDEHAQNLAKKYGRTTAQI 243
            ..||..|:|.::|.||..|..|              :..:.....:.|:|.:.||:||.:|.|||
 Worm   186 AHRELCKKHNILITAYATLGSPGRMSVVGSNGRPLFESTQNSENEMNDKHVKALAQKYSKTPAQI 250

  Fly   244 CLRYLVQLGVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYH--TGQRTVPFSGMSGHKYYP 306
            .||..|::|::.:||::|..|::||..:|||.:|..:|..:|.:.  ..:|...:..::.|...|
 Worm   251 LLRATVEMGIIVIPKTTNPERMKENINIFDFNISNAEVNLLEAHERTKQERLFWWPNVADHPEDP 315

  Fly   307 F 307
            |
 Worm   316 F 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 116/313 (37%)
Tas 6..282 CDD:223739 113/292 (39%)
ZC443.1NP_506205.1 AKR_AKR1G1_CeAKR 5..303 CDD:381380 116/307 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I1629
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm4839
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.