DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and exc-15

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001367925.1 Gene:exc-15 / 178844 WormBaseID:WBGene00020369 Length:333 Species:Caenorhabditis elegans


Alignment Length:317 Identity:118/317 - (37%)
Similarity:179/317 - (56%) Gaps:16/317 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TIRLNNGREMPTLGLGTWK-SFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEGV 70
            :|.||.|.::|..|||||: ..|::...:.|.|||.|||.:|||.:|:||..:|:.:.|.|:.|.
 Worm     5 SIPLNTGAQLPLFGLGTWQVKDEAELTVALRAALDAGYRLIDTAHLYQNEHIIGKVLHEYISSGK 69

  Fly    71 VTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHNDSNV-----HGT 130
            :.||::|||:||....|.|..|.:.....|..|.|||:||||:|.|...| |.:.:.     :|.
 Worm    70 LKREDIFVTSKLPFTAHAPEDVPKCVESQLKALQLEYIDLYLIHCPFPFK-HQEGSFAPLMENGE 133

  Fly   131 LELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPGFQQRQLR 195
            |.:|::.::||||.:|||...|..:::|:|||:..|.:.:.....::|...|||||..:.|::||
 Worm   134 LAVTEIAHIDTWRALEKLYKEGKLKALGVSNFSCNQLQALYDAAEVKPANQQVECHIYWPQQELR 198

  Fly   196 EHAKRHGLVICAYCPLARP-----QPARQWP---PFLYDEHAQNLAKKYGRTTAQICLRYLVQLG 252
            ...|:.|:.:.||.||..|     :|...||   |.| :...:.||.||.:|.|||.:|:|.|.|
 Worm   199 ALCKKLGVTVTAYAPLGSPGRKAARPDGVWPEGDPLL-EPIVKQLAAKYHKTAAQILIRHLTQHG 262

  Fly   253 VVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFND 309
            :..:|||.:..||.||...|||:||.:|:..:....|..|.........|.::|.:|
 Worm   263 ISTIPKSVSPDRIVENISTFDFKLSDEDMHTLNSIETRTRLFIADFAVKHPFFPHDD 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 115/304 (38%)
Tas 6..282 CDD:223739 113/288 (39%)
exc-15NP_001367925.1 AKR_AKR1G1_CeAKR 3..306 CDD:381380 115/302 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.