DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and C35D10.6

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_498011.1 Gene:C35D10.6 / 175645 WormBaseID:WBGene00016443 Length:287 Species:Caenorhabditis elegans


Alignment Length:276 Identity:82/276 - (29%)
Similarity:141/276 - (51%) Gaps:22/276 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNGREMPTLGLGTWKSFESDAYHSTRHALDV----GYRHLDTAFVYENEAEVGQAISEKIAEGVV 71
            ||   ||.:|:|||:..:.:.   .|..:|.    |||.:|||.||.|||::|:.:.:.:....:
 Worm     9 NN---MPLIGIGTWQVQKEEI---LRQVIDAGFKEGYRFIDTAQVYNNEAKIGRILEKLLPANGL 67

  Fly    72 TREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHNDSNVHGTLELTDV 136
            .||::::|:||...:........:...|||||.:||:||.|:|.| |....:::..:..|.    
 Worm    68 KREDIWITSKLAPSNAGVKKARESIEESLSNLKVEYLDLLLIHWP-GSSLKSENPANKKLR---- 127

  Fly   137 DYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPGFQQRQLREHAKRH 201
              :::|..|.:::..|..||:|:|||.....|.:..:..:.|.|||||.||.|.|..|.::...:
 Worm   128 --VESWNVMCEMMAEGKLRSVGVSNFEICHLEELKKDSNVVPAVNQVEYHPHFHQDDLVKYCNEN 190

  Fly   202 GLVICAYCPLARPQPARQWPPFLYDEH-AQNLAKKYGRTTAQICLRYLVQLGVVPLPKSSNKARI 265
            .:...||..|..|...:|    |.:|. .:.||:||......:.|.:....|:..||:::|...:
 Worm   191 NIHFQAYSSLGSPTYRKQ----LSEEPLIKELAQKYNVEIPVLLLGFAYCQGISVLPRTTNPEHV 251

  Fly   266 EENFRVFDFELSPDDV 281
            ..||:|....::.:|:
 Worm   252 ATNFKVTKLAITQEDI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 82/276 (30%)
Tas 6..282 CDD:223739 82/276 (30%)
C35D10.6NP_498011.1 AKR_DrGR-like 11..273 CDD:381362 80/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.