DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and Akr1c3

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_612519.1 Gene:Akr1c3 / 171516 RGDID:708428 Length:323 Species:Rattus norvegicus


Alignment Length:323 Identity:134/323 - (41%)
Similarity:186/323 - (57%) Gaps:12/323 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNLAPTIRLNNGREMPTLGLGTWKSFES---DAYHSTRHALDVGYRHLDTAFVYENEAEVGQAI 62
            |.:....:.||:|..:|.||.||:.:.|:   .:..||:.|:|||:||:|.:.:|:||.|:||||
  Rat     1 MNSKIQKMELNDGHSIPVLGFGTYATEENLRKKSMESTKIAIDVGFRHIDCSHLYQNEEEIGQAI 65

  Fly    63 SEKIAEGVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHND--- 124
            ..||.:|.|.||::|.|:||....|.|.||..:...||..|.|:||||||:|.||..|..::   
  Rat    66 VSKIEDGTVKREDIFYTSKLWSTSHRPELVRPSLENSLRKLNLDYVDLYLIHFPVSLKPGDELLP 130

  Fly   125 SNVHGTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHP 187
            .:.||.|.|..||..|||..|||..|.||.:|||:||||..|.|::|  ...:.|||.||||||.
  Rat   131 QDEHGNLILDTVDLCDTWEAMEKCKDAGLAKSIGVSNFNRRQLEKILNKPGLKHRPVCNQVECHL 195

  Fly   188 GFQQRQLREHAKRHGLVICAYCPLARPQPA----RQWPPFLYDEHAQNLAKKYGRTTAQICLRYL 248
            ...|.:|..:.|.:.:|:.||..|...:..    ...|..|.|.....:||||.||.|.|.|||.
  Rat   196 YLNQSKLLAYCKMNDIVLVAYGALGTQRYKYCINEDTPVLLDDPILCTMAKKYKRTPALIALRYQ 260

  Fly   249 VQLGVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDEF 311
            ::.|:|.|.||.|:.||.||.:||||:|:.||:..::......|..|.:....|..:||:||:
  Rat   261 LERGIVTLVKSFNEERIRENLQVFDFQLASDDMEILDNLDRNLRYFPANMFKAHPNFPFSDEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 128/306 (42%)
Tas 6..282 CDD:223739 126/287 (44%)
Akr1c3NP_612519.1 AKR_AKR1C1-35 6..308 CDD:381334 127/301 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.