DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and AKR1C2

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001345.1 Gene:AKR1C2 / 1646 HGNCID:385 Length:323 Species:Homo sapiens


Alignment Length:321 Identity:135/321 - (42%)
Similarity:182/321 - (56%) Gaps:22/321 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRLNNGREMPTLGLGTWKSFE---SDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEG 69
            ::||:|..||.||.||:...|   |.|..:.:.|::.|:.|:|:|.||.||.:||.||..|||:|
Human     8 VKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADG 72

  Fly    70 VVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQK-----FHNDSNVHG 129
            .|.||::|.|:||....|.|.||..|...||.||.|:||||||:|.||..|     ...|.|  |
Human    73 SVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDEN--G 135

  Fly   130 TLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHPGFQQR 192
            .:....||...||..|||..|.||.:|||:||||....|.:|  ...:.:||.|||||||.|.||
Human   136 KILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQR 200

  Fly   193 QLREHAKRHGLVICAYCPLA--RPQPARQW-----PPFLYDEHAQNLAKKYGRTTAQICLRYLVQ 250
            :|.:..|...:|:.||..|.  |.:|   |     |..|.|.....||||:.||.|.|.|||.:|
Human   201 KLLDFCKSKDIVLVAYSALGSHREEP---WVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQ 262

  Fly   251 LGVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDEF 311
            .|||.|.||.|:.||.:|.:||:|:|:.:::..::..:...|.:.....:|...|||:||:
Human   263 RGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 129/306 (42%)
Tas 6..282 CDD:223739 128/290 (44%)
AKR1C2NP_001345.1 AKR_AKR1C1-35 6..308 CDD:381334 129/304 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.