DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and Akr1b8

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_032038.1 Gene:Akr1b8 / 14187 MGIID:107673 Length:316 Species:Mus musculus


Alignment Length:318 Identity:119/318 - (37%)
Similarity:188/318 - (59%) Gaps:12/318 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LAPTIRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAE 68
            :|..:.|:...:||.:|||||||..:....:.:.|:|.||||:|.|:.|.||.|||:||.|||.|
Mouse     1 MATFVELSTKAKMPIVGLGTWKSPPNQVKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIQEKIKE 65

  Fly    69 GVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVG-----QKFHNDSNVH 128
            ..|.||::|:.:||.....:..|::.|.:.:|::|.|:|:||||:|.|.|     :.|..|.  .
Mouse    66 KAVQREDLFIVSKLWPTCFEKKLLKEAFQKTLTDLKLDYLDLYLIHWPQGLQPGKELFPKDD--Q 128

  Fly   129 GTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHPGFQQ 191
            |.:..:...:|:.|..||:|||.||.:::|:||||..|.||:|  ...:.:||.|||||||...|
Mouse   129 GRILTSKTTFLEAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQ 193

  Fly   192 RQLREHAKRHGLVICAYCPLA---RPQPARQWPPFLYDEHAQNLAKKYGRTTAQICLRYLVQLGV 253
            .:|.::....|:.:.||.||.   ||....:.|..|.|...:.:|.|:.:|:||:.:|:.:|..|
Mouse   194 EKLIQYCHSKGISVTAYSPLGSPDRPSAKPEDPSLLEDPKIKEIAAKHEKTSAQVLIRFHIQRNV 258

  Fly   254 VPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDEF 311
            |.:|||...:||:||.:||||:||.:::|.:..::...|..........:.||::.|:
Mouse   259 VVIPKSVTPSRIQENIQVFDFQLSDEEMATILSFNRNWRACLLPETVNMEEYPYDAEY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 116/303 (38%)
Tas 6..282 CDD:223739 113/285 (40%)
Akr1b8NP_032038.1 ARA1 1..297 CDD:223729 115/297 (39%)
Tas 16..289 CDD:223739 111/274 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.