DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and Akr1c20

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001298061.1 Gene:Akr1c20 / 116852 MGIID:2151104 Length:323 Species:Mus musculus


Alignment Length:326 Identity:134/326 - (41%)
Similarity:184/326 - (56%) Gaps:18/326 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNLAPTIRLNNGREMPTLGLGTWKSFE---SDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAI 62
            |.:...|:.||:|..:|.||.||....|   |.|..:|:.|:|.|:||:|.|.||:||.|||.||
Mouse     1 MNSKQQTVLLNDGHFIPILGFGTSAPQEVPRSKATEATKIAIDAGFRHIDCAAVYQNEKEVGLAI 65

  Fly    63 SEKIAEGVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQK-----FH 122
            ..||.:|.|.||::|.|:|:....|.|.||:.....||..|.|:||||||:|.|:..|     |.
Mouse    66 RSKIVDGTVKREDIFCTSKVWQTFHRPELVQVCLEQSLKQLQLDYVDLYLIHFPIAMKPGENYFP 130

  Fly   123 NDSNVHGTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLA--NCRIRPVVNQVEC 185
            .|.|  |......||..|||..|||..|.||.:|||:.|||..|.|::|:  ..:.:||.|||||
Mouse   131 KDEN--GKFIYDAVDICDTWEAMEKCKDAGLAKSIGVCNFNRRQLEKILSKPGLKYKPVCNQVEC 193

  Fly   186 HPGFQQRQLREHAKRHGLVICAYCPLARPQPARQW-----PPFLYDEHAQNLAKKYGRTTAQICL 245
            ||...||:|.:..:...:|:.|:..|...:. ::|     |..|.|....::||||.||.|.|.|
Mouse   194 HPYLNQRKLLDFCRSKDIVLVAHSALGSNRD-KEWVDKSFPVLLDDPVLGSMAKKYNRTPALIAL 257

  Fly   246 RYLVQLGVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDE 310
            ||.||.|||.|.||..:.||:||.:||:|:|:..|:..::..:...|.:..|....|..:||.||
Mouse   258 RYQVQRGVVVLAKSFIEKRIKENMQVFEFQLTSVDMKVLDGLNKNIRYIGSSISEDHPDFPFLDE 322

  Fly   311 F 311
            :
Mouse   323 Y 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 127/309 (41%)
Tas 6..282 CDD:223739 126/290 (43%)
Akr1c20NP_001298061.1 ARA1 5..317 CDD:223729 129/314 (41%)
Tas 16..297 CDD:223739 122/283 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.