DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and Akr1b3

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_033788.3 Gene:Akr1b3 / 11677 MGIID:1353494 Length:316 Species:Mus musculus


Alignment Length:319 Identity:139/319 - (43%)
Similarity:199/319 - (62%) Gaps:16/319 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LAPTIRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAE 68
            :|..:.||||.:|||||||||||.......:.:.|:|:||||:|.|.||:||.|||.|:.||:.|
Mouse     1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDLGYRHIDCAQVYQNEKEVGVALQEKLKE 65

  Fly    69 GVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQK-----FHNDSNVH 128
            .||.|:::|:.:||....||.::|:.|.:.:||:|.|:|:||||:|.|.|.|     |..|::  
Mouse    66 QVVKRQDLFIVSKLWCTFHDKSMVKGAFQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDAS-- 128

  Fly   129 GTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVECHPGFQQ 191
            |.:..:|.|::|||..||:|||.||.::||:||||..|.||:|  ...:.:|.|||:||||...|
Mouse   129 GNVIPSDTDFVDTWTAMEQLVDEGLVKTIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQ 193

  Fly   192 RQLREHAKRHGLVICAYCPLARPQPARQW-----PPFLYDEHAQNLAKKYGRTTAQICLRYLVQL 251
            .:|.|:....|:|:.||.||..|.  |.|     |..|.|...:.:|.||.:||||:.:|:.:|.
Mouse   194 EKLIEYCHSKGIVVTAYSPLGSPD--RPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPIQR 256

  Fly   252 GVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDE 310
            .:|.:|||....||.||.:|||||:|.:|:|.:..|:...|.......:.||.|||:.|
Mouse   257 NLVVIPKSVTPVRIAENLKVFDFEVSSEDMATLLSYNRNWRVCALMSCAKHKDYPFHAE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 133/305 (44%)
Tas 6..282 CDD:223739 129/287 (45%)
Akr1b3NP_033788.3 ARA1 1..297 CDD:223729 132/299 (44%)
Tas 8..289 CDD:223739 129/284 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.